| Clone Name | rbastl40f03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TNF10_HUMAN (P50591) Tumor necrosis factor ligand superfamily me... | 30 | 1.9 | 2 | ATU_DROME (Q94546) Another transcription unit protein | 30 | 1.9 | 3 | GCSPB_STAHJ (Q4L6N5) Probable glycine dehydrogenase [decarboxyla... | 28 | 5.5 | 4 | RAE2_MOUSE (Q9QZD5) Rab proteins geranylgeranyltransferase compo... | 27 | 9.4 |
|---|
>TNF10_HUMAN (P50591) Tumor necrosis factor ligand superfamily member 10| (TNF-related apoptosis-inducing ligand) (TRAIL protein) (Apo-2 ligand) (Apo-2L) (CD253 antigen) Length = 281 Score = 29.6 bits (65), Expect = 1.9 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 276 SAW*EIRSSHGYAKNLHVQNGDLM 347 ++W RS H + NLH++NG+L+ Sbjct: 152 NSWESSRSGHSFLSNLHLRNGELV 175
>ATU_DROME (Q94546) Another transcription unit protein| Length = 725 Score = 29.6 bits (65), Expect = 1.9 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = -3 Query: 357 SQTPSSPRSERVGSLHSHESF*SPTMQKNNRSKLQPFGE*SLRMCGTARVR 205 S TP SP+S R GSL S +S SP +++ + + G R G+A R Sbjct: 102 SGTPESPQSHRSGSLQSRKSG-SPQSRRSGSPQSRKSGSTHSRRSGSAHSR 151
>GCSPB_STAHJ (Q4L6N5) Probable glycine dehydrogenase [decarboxylating] subunit 2| (EC 1.4.4.2) (Glycine decarboxylase subunit 2) (Glycine cleavage system P-protein subunit 2) Length = 492 Score = 28.1 bits (61), Expect = 5.5 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -3 Query: 258 LQPFGE*SLRMCGTARVRNG--LRSIFSVHNFVPVIAFCLHPFVLLGAKVKQAVLR 97 ++ G LR A V N +++ H +P +C H FVL G+K K+ +R Sbjct: 342 IRTMGAEGLREVSEAAVLNANYIKASLKDHYEIPYEQYCKHEFVLSGSKQKEHGVR 397
>RAE2_MOUSE (Q9QZD5) Rab proteins geranylgeranyltransferase component A 2 (Rab| escort protein 2) (REP-2) (Choroideraemia-like protein) Length = 621 Score = 27.3 bits (59), Expect = 9.4 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Frame = -1 Query: 296 SDLLPCRKTTGPNYSHLVNNRYACVVPRALETV*G-----PFFQCIILFPSSPFVYIL 138 SD L +K T PN H + + A + T+ G F QC+ F ++PF++ L Sbjct: 322 SDYLKTKKLT-PNLQHFILHSIAMTSESSCTTLDGLQATKNFLQCLGRFGNTPFIFPL 378 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,514,253 Number of Sequences: 219361 Number of extensions: 1178029 Number of successful extensions: 2433 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2432 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)