Clone Name | rbastl40e08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CR2_MOUSE (P19070) Complement receptor type 2 precursor (Cr2) (C... | 28 | 7.2 | 2 | WNK1_HUMAN (Q9H4A3) Serine/threonine-protein kinase WNK1 (EC 2.7... | 28 | 7.2 | 3 | HAT1_DEBHA (Q6BSQ1) Histone acetyltransferase type B catalytic s... | 28 | 9.4 |
---|
>CR2_MOUSE (P19070) Complement receptor type 2 precursor (Cr2) (Complement C3d| receptor) (CD21 antigen) Length = 1025 Score = 28.5 bits (62), Expect = 7.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 126 YFGKLSCDPSPESEKYRGSFATVYVVHT*IDRVEC 22 YF ++SCDP PE + R + ++ +V + R C Sbjct: 8 YFSEISCDPPPEVKNARKPYYSLPIVPGTVLRYTC 42
>WNK1_HUMAN (Q9H4A3) Serine/threonine-protein kinase WNK1 (EC 2.7.11.1)| (Protein kinase with no lysine 1) (Protein kinase, lysine-deficient 1) (Kinase deficient protein) Length = 2382 Score = 28.5 bits (62), Expect = 7.2 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 Query: 251 HFTAHFKPIGQPQDKLPTYLLELYSV 328 H AHF P+GQP LPT LL Y V Sbjct: 819 HSGAHFLPVGQP---LPTPLLPQYPV 841
>HAT1_DEBHA (Q6BSQ1) Histone acetyltransferase type B catalytic subunit (EC| 2.3.1.48) Length = 409 Score = 28.1 bits (61), Expect = 9.4 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 313 KKISR*LVLRLSDWFKMGGEVANHVKLAEFWFQ 215 KKIS+ +VL + K+GG N KL E+W Q Sbjct: 226 KKISQFIVLPMYQGLKLGGRFYN--KLYEYWMQ 256 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,057,747 Number of Sequences: 219361 Number of extensions: 1180424 Number of successful extensions: 2802 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2765 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2802 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)