Clone Name | rbastl40e07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y3208_DESVH (Q726E5) UPF0078 membrane protein DVU3208 | 33 | 0.16 | 2 | RADA_TREPA (O83985) DNA repair protein radA homolog (DNA repair ... | 28 | 5.1 | 3 | MIB2_CHICK (Q5ZIJ9) Ubiquitin ligase protein MIB2 (EC 6.3.2.-) (... | 28 | 8.7 |
---|
>Y3208_DESVH (Q726E5) UPF0078 membrane protein DVU3208| Length = 327 Score = 33.5 bits (75), Expect = 0.16 Identities = 20/47 (42%), Positives = 25/47 (53%) Frame = -3 Query: 154 NVHRNLIARLTSMCVGVLTLVCDL*DKTLPVS*ILVAHSNLMFKLLT 14 NV +ARL VGVLTLVCD +PV+ L + +F LT Sbjct: 38 NVGATNVARLCGTKVGVLTLVCDALKGAIPVAVALSISDSTVFHSLT 84
>RADA_TREPA (O83985) DNA repair protein radA homolog (DNA repair protein sms| homolog) Length = 455 Score = 28.5 bits (62), Expect = 5.1 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 27 NIKLLCATRIHETGNVLSQRSQTNV 101 NI+LLCATR+ + VL+ R T V Sbjct: 143 NIELLCATRVEDVERVLNTRCPTFV 167
>MIB2_CHICK (Q5ZIJ9) Ubiquitin ligase protein MIB2 (EC 6.3.2.-) (Mind bomb| homolog 2) Length = 954 Score = 27.7 bits (60), Expect = 8.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 51 RIHETGNVLSQRSQTNVSTPTHILVNRAIKFLCTFGP 161 R+H T N ++ S ++V+ PT LV + L F P Sbjct: 808 RVHTTPNTMTNLSVSSVAVPTECLVCSELALLIHFFP 844 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,220,739 Number of Sequences: 219361 Number of extensions: 371721 Number of successful extensions: 841 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 839 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)