| Clone Name | rbastl40e05 |
|---|---|
| Clone Library Name | barley_pub |
>RL15_FRATT (Q5NHU9) 50S ribosomal protein L15| Length = 143 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +3 Query: 291 GFSSTLGKGHEKTGMAARSGC*HQ*SLAEGSVPLELGVP 407 G T GKGH+ G ARSG H+ G +PL+ +P Sbjct: 26 GLGKTSGKGHK--GQKARSGGYHKVGFEGGQMPLQRRLP 62
>RL15_BUCBP (Q89A84) 50S ribosomal protein L15| Length = 147 Score = 29.3 bits (64), Expect = 2.3 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 291 GFSSTLGKGHEKTGMAARSGC*HQ*SLAEGSVPLELGVP 407 GF T G+GH+ G +RSGC + G +PL +P Sbjct: 26 GFGKTSGRGHK--GQKSRSGCKIRRGFEGGQMPLYRRIP 62
>ENP2_HUMAN (Q9Y5L3) Ectonucleoside triphosphate diphosphohydrolase 2 (EC| 3.6.1.-) (NTPDase2) (Ecto-ATPase) (CD39 antigen-like 1) Length = 495 Score = 28.9 bits (63), Expect = 3.0 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = -3 Query: 284 LLGKNYITPCKLQV---DCHAATLTRLSGVNLDHVC*QK*SGLWSFPRMYC*TCLFPCLF 114 LLG Y +PC + + +++ LSG + H+C SGL+SF C F +F Sbjct: 275 LLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVF 334 Query: 113 YP 108 P Sbjct: 335 QP 336
>RL15_DECAR (Q47J84) 50S ribosomal protein L15| Length = 144 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 291 GFSSTLGKGHEKTGMAARSGC*HQ*SLAEGSVPLELGVP 407 G T G+GH+ G +RSG H+ G +PL+ +P Sbjct: 26 GLGKTCGRGHK--GQKSRSGGFHKVGFEGGQMPLQRRLP 62
>RL15_BURPS (Q63Q30) 50S ribosomal protein L15| Length = 144 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 291 GFSSTLGKGHEKTGMAARSGC*HQ*SLAEGSVPLELGVP 407 G T G+GH+ G +RSG H+ G +PL+ +P Sbjct: 26 GLGKTAGRGHK--GQKSRSGGFHKVGFEGGQMPLQRRLP 62
>RL15_BURMA (Q62GM4) 50S ribosomal protein L15| Length = 144 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 291 GFSSTLGKGHEKTGMAARSGC*HQ*SLAEGSVPLELGVP 407 G T G+GH+ G +RSG H+ G +PL+ +P Sbjct: 26 GLGKTAGRGHK--GQKSRSGGFHKVGFEGGQMPLQRRLP 62
>Y1276_MYCTU (Q11043) Hypothetical protein Rv1276c/MT1313| Length = 158 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 227 WQHGNRPGVCTVLCSSSPEASRV*FHTG 310 W N P V VLCS++ A + HTG Sbjct: 33 WLRANLPAVDAVLCSTATRARQTLAHTG 60
>RL15_BORPE (Q7VTB2) 50S ribosomal protein L15| Length = 146 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 291 GFSSTLGKGHEKTGMAARSGC*HQ*SLAEGSVPLELGVP 407 G T G+GH+ G +RSG H+ G +PL+ +P Sbjct: 29 GLGKTAGRGHK--GQKSRSGGFHKVGFEGGQMPLQRRLP 65
>RL15_BORPA (Q7W2D6) 50S ribosomal protein L15| Length = 146 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 291 GFSSTLGKGHEKTGMAARSGC*HQ*SLAEGSVPLELGVP 407 G T G+GH+ G +RSG H+ G +PL+ +P Sbjct: 29 GLGKTAGRGHK--GQKSRSGGFHKVGFEGGQMPLQRRLP 65
>RL15_BORBR (Q7WRA4) 50S ribosomal protein L15| Length = 146 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 291 GFSSTLGKGHEKTGMAARSGC*HQ*SLAEGSVPLELGVP 407 G T G+GH+ G +RSG H+ G +PL+ +P Sbjct: 29 GLGKTAGRGHK--GQKSRSGGFHKVGFEGGQMPLQRRLP 65
>RL15_METCA (Q605D1) 50S ribosomal protein L15| Length = 144 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +3 Query: 291 GFSSTLGK--GHEKTGMAARSGC*HQ*SLAEGSVPLELGVP 407 G STLGK G G AR+G H+ G +PL+ +P Sbjct: 22 GIGSTLGKTCGRGHKGQKARAGGFHKVGFEGGQMPLQRRLP 62
>CARB_CLOAB (Q97FT3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1065 Score = 27.3 bits (59), Expect = 8.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 Query: 56 CTHGTWMVEEAGY 18 C HG W ++EAGY Sbjct: 576 CVHGVWAIKEAGY 588
>BPHF_BURCE (P37332) Biphenyl dioxygenase system ferredoxin subunit| Length = 109 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 80 ELQVLCSHCTHGTWMVEEAGYMQ 12 EL CTHG W + + GY++ Sbjct: 35 ELFATQDRCTHGDWSLSDGGYLE 57 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,252,073 Number of Sequences: 219361 Number of extensions: 1159427 Number of successful extensions: 2486 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2486 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)