Clone Name | rbastl40d10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CP312_DROME (Q9VVN6) Probable cytochrome P450 312a1 (EC 1.14.-.-... | 30 | 2.3 | 2 | MRPD_BACSU (O05229) Na(+)/H(+) antiporter subunit D (Multiple re... | 30 | 4.0 |
---|
>CP312_DROME (Q9VVN6) Probable cytochrome P450 312a1 (EC 1.14.-.-) (CYPCCCXIIA1)| Length = 510 Score = 30.4 bits (67), Expect = 2.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +3 Query: 270 PTELKFTGKIS*LAKLIIP*ELR*LPKLFMVQLDLQKLKAWLTTPVILID 419 P L F G + LAKL+ P LR ++ L + K W+ T + L+D Sbjct: 37 PPALPFIGHLHILAKLVGPHPLRRATEMINEHLHDHRAKLWMGTKLYLVD 86
>MRPD_BACSU (O05229) Na(+)/H(+) antiporter subunit D (Multiple resistance and| pH homeostasis protein D) (Mrp complex subunit D) Length = 493 Score = 29.6 bits (65), Expect = 4.0 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +3 Query: 129 NILFFLNAELCASNTILLTRHSFWENEEENPQTTFQHGKASVYP 260 ++L L++ L + + + H+FW E+E P+ + K +YP Sbjct: 408 SMLILLSSLLVLYSVLRIFIHAFWGEEKETPKPNHRTAKGLLYP 451 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,979,931 Number of Sequences: 219361 Number of extensions: 1337895 Number of successful extensions: 3408 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3397 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)