ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl40d05 |
|---|---|
| Clone Library Name | barley_pub |
>MMT1_HORVU (Q9MBC2) Methionine S-methyltransferase (EC 2.1.1.12) (AdoMet:Met| S-methyltransferase) (Hv-MMT1) Length = 1088 Score = 31.2 bits (69), Expect = 1.2 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 146 LAVFPSDDVFISQVLGLFSPGSGILDERM 60 + VFPS V I L LFSPG I+DE + Sbjct: 455 VVVFPSRAVAIENALRLFSPGLAIVDEHL 483
>ATG26_NEUCR (Q7S1I0) Sterol 3-beta-glucosyltransferase (EC 2.4.1.173)| (Autophagy-related protein 26) Length = 1553 Score = 30.4 bits (67), Expect = 2.0 Identities = 28/111 (25%), Positives = 46/111 (41%) Frame = +1 Query: 103 NT*EINTSSEGKTASR*EDDDYIHISFQHTGMAFSTPAHPRTVKNQDPVHDGLTKQCDAP 282 +T + + EG+++ ED+D + H M F+ P T +N++ G K Sbjct: 131 STVDFHDRFEGQSS---EDEDDVP---NHMAMTFAGPGIKGTARNRETA--GTVKSL--- 179 Query: 283 NKH*RRSELASDEGEFNMPPEVSSARPIPVLFHQQQWPRRKIWSVTPSLSR 435 S FN PP ++ P H+++ P K+ PSLSR Sbjct: 180 ----------SQTVVFNKPPASATVDAGPSNIHRRRLPGHKLLQSVPSLSR 220
>FPPS_CHICK (P08836) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 367 Score = 30.4 bits (67), Expect = 2.0 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -2 Query: 419 VTDQ-IFRRGHCCWWNKTGIGLAELTSGGMLNS 324 + DQ + RRG CW+ K G+GL + +L S Sbjct: 119 IMDQSLTRRGQLCWYKKEGVGLDAINDSFLLES 151
>FPPS_HUMAN (P14324) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 353 Score = 30.0 bits (66), Expect = 2.6 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 401 RRGHCCWWNKTGIGLAELTSGGMLNS 324 RRG CW+ K G+GL + +L + Sbjct: 112 RRGQICWYQKPGVGLDAINDANLLEA 137
>MMT1_MAIZE (Q8W519) Methionine S-methyltransferase (EC 2.1.1.12) (AdoMet:Met| S-methyltransferase) Length = 1091 Score = 29.6 bits (65), Expect = 3.4 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 146 LAVFPSDDVFISQVLGLFSPGSGILDERM 60 + VFPS V I L LFSP I+DE + Sbjct: 457 VVVFPSRSVAIENALQLFSPALAIVDEHL 485
>BARH1_DROAN (P22544) Homeobox protein B-H1 (Homeobox BarH1 protein)| Length = 606 Score = 29.6 bits (65), Expect = 3.4 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +2 Query: 290 TRDAPN*HPTRVSSTCPRKLAPQGRSPSYSTNSNGPDGRSGRSLPAC 430 T P HP+R S P P R PS + + P GRS+ +C Sbjct: 547 TGGMPPHHPSRPDSASPPLPLPLARPPSTPSPTLNPGSPPGRSVDSC 593
>FPPS_NEUCR (Q92250) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 347 Score = 29.3 bits (64), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 407 IFRRGHCCWWNKTGIGLAELTSGGMLNS 324 I RRG CW+ + G+G+ + ML S Sbjct: 102 ITRRGKPCWYRQEGVGMVAINDAFMLES 129
>FPPS_GIBFU (Q92235) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 347 Score = 29.3 bits (64), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 407 IFRRGHCCWWNKTGIGLAELTSGGMLNS 324 I RRG CW+ + G+G+ + ML S Sbjct: 102 ITRRGQPCWYRQEGVGMIAINDAFMLES 129
>FPPS_RAT (P05369) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) (Cholesterol-regulated 39 kDa protein) (CR 39) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 353 Score = 28.9 bits (63), Expect = 5.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 401 RRGHCCWWNKTGIGLAELTSGGMLNS 324 RRG CW+ K GIGL + +L + Sbjct: 112 RRGQICWYQKPGIGLDAINDALLLEA 137
>FPPS_MOUSE (Q920E5) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) (Cholesterol-regulated 39 kDa protein) (CR 39) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 353 Score = 28.9 bits (63), Expect = 5.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 401 RRGHCCWWNKTGIGLAELTSGGMLNS 324 RRG CW+ K GIGL + +L + Sbjct: 112 RRGQICWYQKPGIGLDAINDALLLEA 137
>SYP1_YEAST (P25623) Suppressor of yeast profilin deletion| Length = 870 Score = 28.5 bits (62), Expect = 7.6 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 281 QTNTRDAPN*HPTRVSSTCPRKLAPQGRSPSYSTNSN 391 Q + + PN TRVSST + + R P+YS++ + Sbjct: 369 QASITETPNNSSTRVSSTATSSIYQKQRRPTYSSSKS 405
>SPRI_DROME (Q8MQW8) Protein sprint (SH2 poly-proline-containing Ras-interactor| protein) Length = 1790 Score = 28.5 bits (62), Expect = 7.6 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +3 Query: 78 TTTRRKQP*HLRNKHII*RKNSQQMRRRRLHSHFFST 188 TTT R+Q H N H N QQM+ R+LH+H + + Sbjct: 55 TTTNRQQQHH--NHH-----NQQQMQSRQLHAHHWQS 84
>CRYAA_ORYLA (O73919) Alpha crystallin A chain (Fragment)| Length = 145 Score = 28.1 bits (61), Expect = 9.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +2 Query: 386 SNGPDGRSGRSLPACR 433 + GP+GRS RS+P CR Sbjct: 130 AGGPNGRSDRSIPVCR 145 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,037,509 Number of Sequences: 219361 Number of extensions: 1244529 Number of successful extensions: 2831 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2830 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
