Clone Name | rbastl40d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PLSX_PROMM (Q7V4F7) Fatty acid/phospholipid synthesis protein plsX | 30 | 3.5 | 2 | ABCA3_HUMAN (Q99758) ATP-binding cassette sub-family A member 3 ... | 29 | 6.0 | 3 | YWV1_CAEEL (Q11075) Hypothetical protein B0403.1 | 28 | 7.9 | 4 | MYX2_CROVC (P12029) Myotoxin-2 (Myotoxin II) | 28 | 7.9 | 5 | VG12_SHV21 (P24915) Hypothetical gene 12 protein | 28 | 7.9 |
---|
>PLSX_PROMM (Q7V4F7) Fatty acid/phospholipid synthesis protein plsX| Length = 448 Score = 29.6 bits (65), Expect = 3.5 Identities = 17/54 (31%), Positives = 32/54 (59%) Frame = +3 Query: 144 KPQS*HRKHVWKRKSAQV*HLSW*ACNSCSYSGNVSAILSIRSSGKICAWRGAV 305 +P++ R +W R++A V L A NS S +GNV+ + + S+G + + G++ Sbjct: 20 RPRAIRRLVIWYRRNAAVTSLVGSATNSASAAGNVAGTV-VSSAGSVVSNAGSM 72
>ABCA3_HUMAN (Q99758) ATP-binding cassette sub-family A member 3 (ATP-binding| cassette transporter 3) (ATP-binding cassette 3) (ABC-C transporter) Length = 1704 Score = 28.9 bits (63), Expect = 6.0 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 8/47 (17%) Frame = -3 Query: 195 LVQIFFSKHVFYVSFGAFIIFISFVVCF----RYS----ACSLCSCM 79 +V FFSK +FG F+ F +++ F RY+ + LCSC+ Sbjct: 363 MVSTFFSKANMAAAFGGFLYFFTYIPYFFVAPRYNWMTLSQKLCSCL 409
>YWV1_CAEEL (Q11075) Hypothetical protein B0403.1| Length = 198 Score = 28.5 bits (62), Expect = 7.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 180 FSKHVFYVSFGAFIIFISFVVCFRYSACSL 91 F KH+ YVS AF+ + CFR++ SL Sbjct: 23 FQKHIEYVSNSAFLKCRQLLRCFRFTNVSL 52
>MYX2_CROVC (P12029) Myotoxin-2 (Myotoxin II)| Length = 43 Score = 28.5 bits (62), Expect = 7.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 341 HKTSGSFIDSEIYCTPPSADFAR 273 HK G E CTPPS+DF + Sbjct: 5 HKKGGHCFPKEKICTPPSSDFGK 27
>VG12_SHV21 (P24915) Hypothetical gene 12 protein| Length = 169 Score = 28.5 bits (62), Expect = 7.9 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 135 FISFVVCFRYSACSLCSCMK*WTTMYYWDSPLLVDEKYHSFY 10 +I VC C LC + T+ W S +L E Y++FY Sbjct: 75 WIVLCVCVSTLLCILCILLDICLTIRLWQSSVLCYEVYNTFY 116 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,924,500 Number of Sequences: 219361 Number of extensions: 1034009 Number of successful extensions: 3191 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3095 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3187 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)