Clone Name | rbastl40d02 |
---|---|
Clone Library Name | barley_pub |
>MLL3_MOUSE (Q8BRH4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) Length = 4903 Score = 30.0 bits (66), Expect = 1.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 374 SIPDRAYCCRWCSWCKVCSEDS 309 ++P + C+WC WC+ C S Sbjct: 1036 TVPKGGWKCKWCVWCRHCGATS 1057
>MLL3_HUMAN (Q8NEZ4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) (Homologous to ALR protein) Length = 4911 Score = 30.0 bits (66), Expect = 1.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 374 SIPDRAYCCRWCSWCKVCSEDS 309 ++P + C+WC WC+ C S Sbjct: 1043 TVPKGGWKCKWCVWCRHCGATS 1064
>ZNHI2_HUMAN (Q9UHR6) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 403 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -1 Query: 295 VPLFFEAMESLIK*-VTGNLRMDIPSKLFSYEHTAVLFHG 179 VP A+ SL + V+ +R +P+ LF+Y HT L+HG Sbjct: 192 VPTRIPAIVSLSRGPVSPLVRFQLPNVLFAYAHTLALYHG 231
>ZNHI2_MOUSE (Q9QY66) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 399 Score = 29.3 bits (64), Expect = 2.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 241 LRMDIPSKLFSYEHTAVLFHG 179 +R +P+ LF+Y HT L+HG Sbjct: 206 VRFQLPNVLFAYAHTLALYHG 226
>PXDC2_XENLA (Q6DE92) Plexin domain-containing protein 2 precursor| Length = 513 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 19/51 (37%) Frame = -3 Query: 341 CSWCKV-------------------CSEDSKQGVCASIL*SYGVSYQVSDG 246 CSWC + C+E+SK VC +L + G+S+ + G Sbjct: 331 CSWCNIPQRCSSGFDRHRQDWVENGCTEESKDTVCDDLLQTTGISHHTTTG 381
>YFC3_SCHPO (O14138) Hypothetical protein C25A8.03c in chromosome I| Length = 467 Score = 28.1 bits (61), Expect = 5.4 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = -2 Query: 198 QLCCFMEVSVNCIVLLLCYFYFTVFKLLVSWFQNFLGILILDIL 67 Q F E N +VL YF VF L + F + GI+ LDIL Sbjct: 126 QRSLFSESISNYLVLQYKLRYFPVFDLKIYDFHSGTGIIALDIL 169
>MPAA5_AMBEL (P02878) Pollen allergen Amb a 5 (Amb a V) (Allergen Ra5)| Length = 45 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 4/23 (17%) Frame = -3 Query: 362 RAYCC----RWCSWCKVCSEDSK 306 RAYCC R+C W VC E S+ Sbjct: 15 RAYCCSDPGRYCPWQVVCYESSE 37
>MPA5A_AMBPS (P43174) Pollen allergen Amb p 5a precursor (Amb p Va)| Length = 77 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 4/23 (17%) Frame = -3 Query: 362 RAYCC----RWCSWCKVCSEDSK 306 RAYCC R+C W VC E S+ Sbjct: 37 RAYCCSDPGRYCPWQVVCYESSE 59
>MUKB_MANSM (Q65TL9) Chromosome partition protein mukB (Structural maintenance| of chromosome-related protein) Length = 1499 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +1 Query: 280 QRIEAQ-TPCLESSLHTLHQEHQRQQ*AL 363 Q+++AQ TP L + LH L Q +Q+QQ A+ Sbjct: 537 QKLQAQQTPQLRAKLHELEQRYQQQQSAV 565
>UHMK1_RAT (Q63285) Serine/threonine-protein kinase Kist (EC 2.7.11.1) (Kinase| interacting with stathmin) (U2AF homology motif kinase 1) (PAM COOH-terminal interactor protein 2) (P-CIP2) Length = 419 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 285 NRGTNSLFGVFTAHFAPGAPT 347 +R +L+GVFT HF+P P+ Sbjct: 86 HRNIVTLYGVFTIHFSPNVPS 106
>UHMK1_MOUSE (P97343) Serine/threonine-protein kinase Kist (EC 2.7.11.1) (Kinase| interacting with stathmin) (U2AF homology motif kinase 1) Length = 419 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 285 NRGTNSLFGVFTAHFAPGAPT 347 +R +L+GVFT HF+P P+ Sbjct: 86 HRNIVTLYGVFTIHFSPNVPS 106
>UHMK1_HUMAN (Q8TAS1) Serine/threonine-protein kinase Kist (EC 2.7.11.1) (Kinase| interacting with stathmin) (U2AF homology motif kinase 1) Length = 419 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 285 NRGTNSLFGVFTAHFAPGAPT 347 +R +L+GVFT HF+P P+ Sbjct: 86 HRNIVTLYGVFTIHFSPNVPS 106
>ATP6_AEDAL (Q5JCK5) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 226 Score = 27.3 bits (59), Expect = 9.2 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = -2 Query: 132 TVFKLLVSWFQNFLGILIL 76 T+F + ++WF F+G+LI+ Sbjct: 14 TIFNMSLNWFSTFIGLLII 32 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,386,188 Number of Sequences: 219361 Number of extensions: 873487 Number of successful extensions: 2436 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2433 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)