| Clone Name | rbastl40c11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IBP7_MOUSE (Q61581) Insulin-like growth factor-binding protein 7... | 28 | 8.5 | 2 | CSF1_HUMAN (P09603) Macrophage colony-stimulating factor 1 precu... | 28 | 8.5 | 3 | TGIF_PANTR (Q5IS58) 5'-TG-3'-interacting factor (Homeobox protei... | 28 | 8.5 | 4 | IBB1_COILA (P07679) Bowman-Birk type trypsin inhibitor TI1 | 28 | 8.5 |
|---|
>IBP7_MOUSE (Q61581) Insulin-like growth factor-binding protein 7 precursor| (IGFBP-7) (IBP-7) (IGF-binding protein 7) (MAC25 protein) Length = 281 Score = 27.7 bits (60), Expect = 8.5 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +2 Query: 80 ETKSSCICVPAAAR-DAEPAGTSSSSLPHLGP 172 ET+ +C C P AR + EP G ++ H P Sbjct: 51 ETRDACGCCPVCARGEGEPCGGGAAGRGHCAP 82
>CSF1_HUMAN (P09603) Macrophage colony-stimulating factor 1 precursor (CSF-1)| (MCSF) (M-CSF) (Lanimostim) Length = 554 Score = 27.7 bits (60), Expect = 8.5 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 104 VPAAARDAEPAGTSSSSLPHLGPRSP 181 +PA+A+ +PA + ++LP +GP P Sbjct: 350 LPASAKGQQPADVTGTALPRVGPVRP 375
>TGIF_PANTR (Q5IS58) 5'-TG-3'-interacting factor (Homeobox protein TGIF)| Length = 401 Score = 27.7 bits (60), Expect = 8.5 Identities = 17/49 (34%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +2 Query: 56 LWINIKTRETK--SSCICVPAAARDAEPAGTSSSSLPHLGPRSPGYWSL 196 LW ++ T SSC P AR +P S GPR P W L Sbjct: 64 LWSSLATPSALLGSSCAPPPPPARCPQPRALSPELGTKAGPRRPHRWEL 112
>IBB1_COILA (P07679) Bowman-Birk type trypsin inhibitor TI1| Length = 64 Score = 27.7 bits (60), Expect = 8.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 204 HVCNDQYPGDLGPRCGKD 151 HVC D Y GD GP C D Sbjct: 47 HVCFDTYIGDPGPTCHDD 64 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,682,668 Number of Sequences: 219361 Number of extensions: 338178 Number of successful extensions: 915 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)