Clone Name | rbastl40c07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SWP1_ENCCU (Q9XZV1) Spore wall protein 1 precursor | 28 | 6.8 |
---|
>SWP1_ENCCU (Q9XZV1) Spore wall protein 1 precursor| Length = 450 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 8/49 (16%) Frame = +2 Query: 245 YQNQKALSTTRCDRPTDQSSFISSKCSP--------CPFILSVVVLTVG 367 Y++ + ++ CD + SS +SS+CSP C + L ++ +G Sbjct: 87 YEDSCSFGSSDCDDSSTYSSCVSSECSPPCRPVPLNCDYELKTPIINMG 135 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,273,392 Number of Sequences: 219361 Number of extensions: 1007187 Number of successful extensions: 2061 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2040 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2061 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)