ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl40c06 |
|---|---|
| Clone Library Name | barley_pub |
>SQD1_SPIOL (Q84KI6) UDP-sulfoquinovose synthase, chloroplast precursor (EC| 3.13.1.1) (Sulfite:UDP-glucose sulfotransferase) (Sulfolipid biosynthesis protein) (SoSQD1) Length = 482 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 390 DTAQIMPSVSWKKMGAKPKTI 328 DT QIMPSVSWKK+G KP+T+ Sbjct: 460 DTKQIMPSVSWKKIGVKPQTL 480
>SQD1_ARATH (O48917) UDP-sulfoquinovose synthase, chloroplast precursor (EC| 3.13.1.1) (Sulfite:UDP-glucose sulfotransferase) (Sulfolipid biosynthesis protein) Length = 477 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = -3 Query: 390 DTAQIMPSVSWKKMGAKPKTIS 325 DT QIMPSVSWKK+G K K+++ Sbjct: 455 DTKQIMPSVSWKKIGVKTKSMT 476
>VD05_FOWPV (P21969) Protein FPV058| Length = 791 Score = 34.3 bits (77), Expect = 0.074 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 2/89 (2%) Frame = +1 Query: 115 LSNCSSHPGGKNEIYYNSVNQQLPRLNYSVYTKTSAHYYRYITHNKI*CQWHG*HHTPHN 294 L N +H + +NS + LN S+ +K ++Y+RY KI W +H P+ Sbjct: 625 LVNFKTHFTNTKKKVHNSKYDFIKPLNESLDSKIQSNYFRY-AFLKILLGWFSKYHVPNL 683 Query: 295 R--GGAPSLPLYRDRLRLGSHLLPRHAGH 375 R +P ++ RL++ S ++P ++ H Sbjct: 684 RILPTPDKIPDFKFRLKVESLIIPSNSTH 712
>V2A_CCMV (P20179) RNA-directed RNA polymerase 2A (EC 2.7.7.48) (protein 2A)| Length = 808 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 6/36 (16%) Frame = +1 Query: 289 HNRGGAPSLPLYRDRLRL------GSHLLPRHAGHD 378 H+ P++P Y DR+ L G H+LP HA D Sbjct: 222 HSEADDPTMPQYHDRISLKSLEAAGHHMLPTHAYFD 257
>LACR_STAXY (O33813) Lactose operon transcription activator| Length = 279 Score = 28.9 bits (63), Expect = 3.1 Identities = 19/66 (28%), Positives = 33/66 (50%) Frame = +1 Query: 40 CSPKPLVTPTVAKFASQN*QHTTHMLSNCSSHPGGKNEIYYNSVNQQLPRLNYSVYTKTS 219 CSPK +T ASQ HT+ ++S+ S G K+ + ++ N++ + + S Sbjct: 214 CSPKEYLTYIRMYHASQLLIHTSTLISDISRQVGYKDPLLFSK--------NFTKHFEIS 265 Query: 220 AHYYRY 237 A YR+ Sbjct: 266 ASEYRH 271
>Y1016_GEOSL (Q74EE6) Hypothetical transport protein GSU1016| Length = 546 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 266 GMVDIIRHITEGELRPSLYTEIVFGLAPIFFHDTLGMICAVS 391 G ++ I+HI ELR L E V G + + +G++ A+S Sbjct: 134 GALETIKHIASPELRELLLAEPVVGYSVAYPMGVMGVVLAIS 175
>EFNA3_HUMAN (P52797) Ephrin-A3 precursor (EPH-related receptor tyrosine kinase| ligand 3) (LERK-3) (EHK1 ligand) (EHK1-L) (EFL-2) Length = 238 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 139 GGKNEIYYNSVNQQLPRLNYSVYTKTSAHYYRYITH 246 G ++ +Y+NS NQ L R Y+V + + Y H Sbjct: 30 GNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPH 65
>SPT51_ARATH (Q9STN3) Putative transcription elongation factor SPT5 homolog 1| Length = 1054 Score = 28.1 bits (61), Expect = 5.3 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 358 EEDGSQAEDDLCIEGGTELP 299 EE+ +AEDD ++ GT+LP Sbjct: 103 EEEEDEAEDDFIVDNGTDLP 122
>Y145_MYCPN (P75141) Hypothetical UPF0134 protein MPN145 (E07_orf179)| Length = 179 Score = 27.7 bits (60), Expect = 6.9 Identities = 19/60 (31%), Positives = 29/60 (48%) Frame = +1 Query: 76 KFASQN*QHTTHMLSNCSSHPGGKNEIYYNSVNQQLPRLNYSVYTKTSAHYYRYITHNKI 255 K+ S+N Q SNC + P GK E+ N V +++ KT RY+TH ++ Sbjct: 16 KYTSKNYQ------SNCKTRPDGKLELSLNGVFEEI--------VKTPGK-TRYVTHKQL 60
>NOF_DROME (P16320) 120.7 kDa protein in NOF-FB transposable element| Length = 1056 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 328 LCIEGGTELPLCYVAYDVNHAIDII 254 L +E T+LP CY+ D+ H I +I Sbjct: 432 LLMEERTDLPPCYIRLDIAHLIKMI 456
>GLGC_MYCMO (Q6KHP5) Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)| (ADP-glucose synthase) (ADP-glucose pyrophosphorylase) (ADPGlc PPase) Length = 381 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 151 EIYYNSVNQQLPRLNYSVYTKTSAHYYRYIT 243 ++ N N L N++++TK+S+H +YIT Sbjct: 258 DLIKNHKNLDLREKNWTIFTKSSSHSPQYIT 288
>ACHA3_HUMAN (P32297) Neuronal acetylcholine receptor protein, alpha-3 subunit| precursor Length = 503 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 136 PGGKNEIYYNSVNQQLPRLNYSVYTKTSAHYY 231 PG K++I YN + P + YS+Y + +Y Sbjct: 211 PGYKHDIKYNCCEEIYPDITYSLYIRRLPLFY 242
>ACHA3_BOVIN (Q07263) Neuronal acetylcholine receptor protein, alpha-3 subunit| precursor Length = 495 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 136 PGGKNEIYYNSVNQQLPRLNYSVYTKTSAHYY 231 PG K++I YN + P + YS+Y + +Y Sbjct: 203 PGYKHDIKYNCCEEIYPDITYSLYIRRLPLFY 234
>MAFB_RAT (P54842) Transcription factor MafB (V-maf musculoaponeurotic| fibrosarcoma oncogene homolog B) (Transcription factor MAF1) Length = 323 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 268 HG*HHTPHNRGGAPSLPLYRDRLRLGSHLLPRHAGH 375 H HH PH G P + D LG H P H H Sbjct: 133 HHHHHHPHPHHGYPGAGVTHD--ELGPHAHPHHHHH 166 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,641,009 Number of Sequences: 219361 Number of extensions: 1142857 Number of successful extensions: 2436 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2435 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
