Clone Name | rbastl40b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TR19L_MACFA (Q9N092) Tumor necrosis factor receptor superfamily ... | 30 | 3.4 | 2 | ATC1_DUNBI (P54209) Cation-transporting ATPase CA1 (EC 3.6.3.-) | 28 | 9.9 | 3 | RNY1_YARLI (Q6CAV7) Ribonuclease T2-like precursor (EC 3.1.27.1)... | 28 | 9.9 | 4 | PJA1_MOUSE (O55176) Ubiquitin protein ligase Praja1 (EC 6.3.2.-) | 28 | 9.9 |
---|
>TR19L_MACFA (Q9N092) Tumor necrosis factor receptor superfamily member 19L| precursor (Receptor expressed in lymphoid tissues) Length = 430 Score = 30.0 bits (66), Expect = 3.4 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 125 PPSQNKWLNPSSTTLCMFLPS*CAGRCSGCTPCISSGTCSL 247 PP + LNP TLC P G +PC CSL Sbjct: 33 PPGEEPDLNPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSL 73
>ATC1_DUNBI (P54209) Cation-transporting ATPase CA1 (EC 3.6.3.-)| Length = 1037 Score = 28.5 bits (62), Expect = 9.9 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 459 YVAGVLITRLLEHFGVIEQGASXXXXXPGMSF 364 ++ G + T + HFG++ GAS G+SF Sbjct: 945 WLVGAIATSMALHFGILYTGASAMFGVTGLSF 976
>RNY1_YARLI (Q6CAV7) Ribonuclease T2-like precursor (EC 3.1.27.1) (RNase| T2-like) Length = 406 Score = 28.5 bits (62), Expect = 9.9 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -1 Query: 296 SSWEHSCKKRKTCMSSPKSKC 234 S W H K TCMS+ K KC Sbjct: 145 SFWTHEWNKHATCMSTLKDKC 165
>PJA1_MOUSE (O55176) Ubiquitin protein ligase Praja1 (EC 6.3.2.-)| Length = 605 Score = 28.5 bits (62), Expect = 9.9 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = +2 Query: 80 KYEAQGDICCNYIVHPPSQNKWLNPSST---TLCMFLPS 187 K E ++ C++ H P + WL S T CMFLP+ Sbjct: 540 KGEVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFLPA 578 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,908,861 Number of Sequences: 219361 Number of extensions: 1404780 Number of successful extensions: 3783 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3779 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)