Clone Name | rbastl40b01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RNB_BUCAI (P57354) Exoribonuclease 2 (EC 3.1.13.1) (Exoribonucle... | 28 | 4.4 | 2 | HXKL_ARATH (Q9T071) Probable hexokinase (EC 2.7.1.1) | 28 | 5.7 | 3 | COAT_CVB (P37991) Coat protein (Capsid protein) (CP) | 28 | 7.5 | 4 | GR28A_DROME (Q9VM09) Putative gustatory receptor 28a | 27 | 9.8 |
---|
>RNB_BUCAI (P57354) Exoribonuclease 2 (EC 3.1.13.1) (Exoribonuclease II)| (Ribonuclease II) (RNase II) Length = 649 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 128 KNGDISTCIHKFCTLNKAKPKFNLEHISD 214 KNG+IS I F K+K K + +H+SD Sbjct: 291 KNGNISNKIEFFLAWIKSKSKLSYDHVSD 319
>HXKL_ARATH (Q9T071) Probable hexokinase (EC 2.7.1.1)| Length = 493 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 6 IYTPFKIPNTLFWKAHLACH*PITQFSSSLSETITNP 116 I P +I + W +CH PIT+F +SL NP Sbjct: 273 IREPQEIVVSTEWGDFRSCHLPITEFDASLDAESLNP 309
>COAT_CVB (P37991) Coat protein (Capsid protein) (CP)| Length = 315 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 244 GSSPTPPPSTKDRTSVNHRLR 306 GS+PTPPP RT+ RLR Sbjct: 16 GSTPTPPPPPPARTAEEARLR 36
>GR28A_DROME (Q9VM09) Putative gustatory receptor 28a| Length = 450 Score = 27.3 bits (59), Expect = 9.8 Identities = 16/61 (26%), Positives = 31/61 (50%) Frame = +3 Query: 78 QFSSSLSETITNPL*TERMETSLHVYINSAH*TKQNRSLISNIFQILAEIHLNVRRFFSY 257 ++S L I+ P+ +R + + +N + KQ +SNI +L +I + +F+Y Sbjct: 239 RYSHRLRNLISTPM--KRYSVTSVIRLNPEYAIKQ----VSNIHNLLCDICQTIEEYFTY 292 Query: 258 P 260 P Sbjct: 293 P 293 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,014,413 Number of Sequences: 219361 Number of extensions: 952312 Number of successful extensions: 2204 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2204 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)