| Clone Name | rbastl40a10 |
|---|---|
| Clone Library Name | barley_pub |
>COPB_DICDI (Q23924) Probable coatomer subunit beta (Beta-coat protein)| (Beta-COP) (Fragment) Length = 400 Score = 48.9 bits (115), Expect = 6e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -1 Query: 451 IEKQVDGKLSGYIRIRSKTQGIALSLGDKI 362 IEKQ DGK+SGYIRIR+K Q IA++LG+KI Sbjct: 364 IEKQADGKISGYIRIRAKVQSIAVTLGEKI 393
>COPB_DROME (P45437) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 964 Score = 47.4 bits (111), Expect = 2e-05 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 3/39 (7%) Frame = -1 Query: 454 SIEKQVD---GKLSGYIRIRSKTQGIALSLGDKITLKQK 347 SIEK VD K++G+IRIR+K+QG+ALSLGDKI+ QK Sbjct: 920 SIEKPVDDPDSKVTGHIRIRAKSQGMALSLGDKISSSQK 958
>COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 46.6 bits (109), Expect = 3e-05 Identities = 25/40 (62%), Positives = 31/40 (77%), Gaps = 4/40 (10%) Frame = -1 Query: 454 SIEKQV----DGKLSGYIRIRSKTQGIALSLGDKITLKQK 347 SIEK V D ++G+IRIR+K+QG+ALSLGDKI L QK Sbjct: 910 SIEKPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949
>COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 46.6 bits (109), Expect = 3e-05 Identities = 25/40 (62%), Positives = 31/40 (77%), Gaps = 4/40 (10%) Frame = -1 Query: 454 SIEKQV----DGKLSGYIRIRSKTQGIALSLGDKITLKQK 347 SIEK V D ++G+IRIR+K+QG+ALSLGDKI L QK Sbjct: 910 SIEKPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949
>COPB_SCHPO (Q9UUF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 940 Score = 46.2 bits (108), Expect = 4e-05 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 454 SIEKQVDGKLSGYIRIRSKTQGIALSLG 371 S+EK V G +SG++RIRSKTQGIALSLG Sbjct: 910 SVEKSVSGPISGHVRIRSKTQGIALSLG 937
>COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 40.8 bits (94), Expect = 0.002 Identities = 19/30 (63%), Positives = 25/30 (83%) Frame = -1 Query: 436 DGKLSGYIRIRSKTQGIALSLGDKITLKQK 347 D ++ +IRIR+K+QG+ALSLGDKI L QK Sbjct: 920 DAAVTVHIRIRAKSQGMALSLGDKINLSQK 949
>COPB_YEAST (P41810) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 973 Score = 38.5 bits (88), Expect = 0.008 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -1 Query: 421 GYIRIRSKTQGIALSLGDKITLKQK 347 GY+RIRSK QG+ALSLGD++ L K Sbjct: 939 GYVRIRSKGQGLALSLGDRVALIAK 963
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 29.3 bits (64), Expect = 4.8 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +1 Query: 4 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVGRDHCISRGH 156 + R+ PE ++L TPTQ F +HR+ +K+A + KG + GH Sbjct: 565 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGH 619
>ERG6_PNECA (Q96WX4) Sterol 24-C-methyltransferase (EC 2.1.1.41)| (Delta(24)-sterol C-methyltransferase) Length = 377 Score = 28.5 bits (62), Expect = 8.2 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 309 CHVGGPLCQ---FHTTGTVG**RCSYNVQKIKERDEKRKIARK 190 C VGGP CQ F VG Y +Q+ K EK+ ++ K Sbjct: 135 CGVGGPACQISVFTGANIVGLNNNDYQIQRAKYYSEKKGLSDK 177
>HNK2_XENLA (P42587) Homeobox protein XENK-2| Length = 196 Score = 28.5 bits (62), Expect = 8.2 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +1 Query: 4 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGV 126 + R+ PE ++L TPTQ F +HR+ K+A S KG+ Sbjct: 89 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARSEKGM 133 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,037,410 Number of Sequences: 219361 Number of extensions: 1090663 Number of successful extensions: 2839 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2765 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2839 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)