Clone Name | rbastl40a09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NU2M_NEUCR (Q35140) NADH-ubiquinone oxidoreductase chain 2 (EC 1... | 29 | 3.9 | 2 | K6PF2_SYNY3 (Q55988) 6-phosphofructokinase 2 (EC 2.7.1.11) (Phos... | 29 | 5.1 | 3 | YGB5_YEAST (P33199) Hypothetical 15.0 kDa protein in PDR6-PDR1 i... | 28 | 6.7 | 4 | ZNF73_HUMAN (O43830) Zinc finger protein 73 (Zinc finger protein... | 28 | 8.8 |
---|
>NU2M_NEUCR (Q35140) NADH-ubiquinone oxidoreductase chain 2 (EC 1.6.5.3) (NADH| dehydrogenase subunit 2) Length = 583 Score = 29.3 bits (64), Expect = 3.9 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -3 Query: 414 IFVLFCFIAAIVLYVTPLQVLAALGGFYAMRHPRFRHRLP 295 +F +F F+ +I+ + L + FY MRHPRF ++ P Sbjct: 66 VFQIFIFLISIL--ILQLTSFDPIKKFYIMRHPRFINKWP 103
>K6PF2_SYNY3 (Q55988) 6-phosphofructokinase 2 (EC 2.7.1.11) (Phosphofructokinase| 2) (Phosphohexokinase 2) Length = 384 Score = 28.9 bits (63), Expect = 5.1 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = -2 Query: 280 LLQAFASEGGQYAVKMLLSGGL-IVVIPRITPCLSL*L---AVLLFVTVRRSGLMSLSIV 113 ++Q + G + ++GG I++IP ITPCL+ + + +R+SG IV Sbjct: 184 IVQVMGRDAGHLTLHAGIAGGADIILIPEITPCLTSEIIRNCCYQLMNLRKSGRHFALIV 243 Query: 112 LDAG 101 + G Sbjct: 244 ISEG 247
>YGB5_YEAST (P33199) Hypothetical 15.0 kDa protein in PDR6-PDR1 intergenic| region Length = 130 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 33 DISSTCFQNLASHDKLSAHYFLDPASNTI 119 D+ S CF N D LS + FL P S+ + Sbjct: 72 DVDSLCFSNCFQPDALSGNVFLPPRSSNM 100
>ZNF73_HUMAN (O43830) Zinc finger protein 73 (Zinc finger protein 186) (hZNF2)| Length = 326 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 1 SQAGYLTLHNKIFHQHASKTWQVMISCQHIISWIQHLTR*T 123 SQ YLT+H H + TWQ +C H H ++ T Sbjct: 183 SQKSYLTIH------HRTHTWQKPYACDHCEKAFSHKSKLT 217 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,484,711 Number of Sequences: 219361 Number of extensions: 1231050 Number of successful extensions: 2946 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2946 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)