Clone Name | rbastl40a07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NCPR_PHACH (Q9HDG2) NADPH--cytochrome P450 reductase (EC 1.6.2.4... | 30 | 2.1 | 2 | Y1397_METJA (Q58792) Hypothetical protein MJ1397 precursor | 29 | 3.7 |
---|
>NCPR_PHACH (Q9HDG2) NADPH--cytochrome P450 reductase (EC 1.6.2.4) (CPR)| (P450R) Length = 736 Score = 29.6 bits (65), Expect = 2.1 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 Query: 51 PSSKAVTKGRPNRREKTAKTEEGQKRSI 134 PSSKA G N R+ AK +EG+KR + Sbjct: 40 PSSKAAAGGNGNPRDFIAKMKEGKKRIV 67
>Y1397_METJA (Q58792) Hypothetical protein MJ1397 precursor| Length = 486 Score = 28.9 bits (63), Expect = 3.7 Identities = 16/68 (23%), Positives = 39/68 (57%), Gaps = 4/68 (5%) Frame = +3 Query: 33 QTSDYDPSSKAVTKGRPNRREKTAKTEEGQKRSIFTVNRAFPQIQWPLL----FSKTISE 200 + + + SSK + + + +++E+ ++T+E +K S +N+ + ++PL+ F K + Sbjct: 308 EEKENEESSKTINQMQRHKKEEKSQTQETKKPSKNEMNKQEKERKYPLIIEEKFKKVAAA 367 Query: 201 NATLQSAS 224 AT+ + S Sbjct: 368 IATVTTTS 375 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,441,731 Number of Sequences: 219361 Number of extensions: 588068 Number of successful extensions: 1728 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1725 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)