| Clone Name | rbastl40a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AKL1_YEAST (P38080) Serine/threonine-protein kinase AKL1 (EC 2.7... | 31 | 0.61 | 2 | CI061_HUMAN (Q15884) Protein C9orf61 (Protein X123) | 29 | 3.0 | 3 | SEC8_YEAST (P32855) Exocyst complex component SEC8 | 28 | 4.0 | 4 | RT09_SCHPO (O14006) 40S ribosomal protein S9, mitochondrial prec... | 27 | 8.8 | 5 | Y1286_METJA (Q58682) Hypothetical protein MJ1286 | 27 | 8.8 | 6 | RGA3_SCHPO (O14014) Probable Rho-type GTPase-activating protein 3 | 27 | 8.8 |
|---|
>AKL1_YEAST (P38080) Serine/threonine-protein kinase AKL1 (EC 2.7.11.1)| Length = 1108 Score = 31.2 bits (69), Expect = 0.61 Identities = 20/79 (25%), Positives = 34/79 (43%) Frame = +3 Query: 33 CFQIPTRAEAGLLRLGNSNTLHTYTPTFQTACHAYREGKPEFPANKKVQVMLHRVAFLLG 212 C I +++ L + L TP T A K EFP NK +++ + +L Sbjct: 242 CLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIMLA 301 Query: 213 TVPNMNKIPQLLKCIHGLC 269 PN+ P + + ++ LC Sbjct: 302 ENPNLR--PNIYQVLYHLC 318
>CI061_HUMAN (Q15884) Protein C9orf61 (Protein X123)| Length = 289 Score = 28.9 bits (63), Expect = 3.0 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 39 QIPTRAEAGLLRLGNSNTLHTYTP 110 ++P+R + GLL L + LHT+TP Sbjct: 236 KLPSRRQPGLLHLQSCGDLHTFTP 259
>SEC8_YEAST (P32855) Exocyst complex component SEC8| Length = 1065 Score = 28.5 bits (62), Expect = 4.0 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 8/52 (15%) Frame = +3 Query: 150 PEFPANKKVQVMLHRVAFLLGTVPNMNKIPQLLKC--------IHGLCVKSS 281 P P+ + +R+ FLL T+ N+NK+P IH + VKS+ Sbjct: 311 PLAPSRNQENEGFNRIGFLLKTINNINKLPVAFNIITERAKEEIHNIIVKST 362
>RT09_SCHPO (O14006) 40S ribosomal protein S9, mitochondrial precursor| Length = 132 Score = 27.3 bits (59), Expect = 8.8 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -3 Query: 375 ASVHGTSEQGPSSGVHAASGCEICLQNSSVCRRI*HRDHGCI 250 A+VHG G S VHAA + LQ S+ + I +D C+ Sbjct: 67 ATVHGGGPTGQSGAVHAAISKSLILQEPSLKQVI--KDTHCV 106
>Y1286_METJA (Q58682) Hypothetical protein MJ1286| Length = 595 Score = 27.3 bits (59), Expect = 8.8 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 6/55 (10%) Frame = +3 Query: 129 HAYR--EGKPEFPANKKVQVMLHRVAFLL--GTVPNM--NKIPQLLKCIHGLCVK 275 HAY+ E K E A + + V++ ++F L GT M + +P LLK IHGL V+ Sbjct: 488 HAYKLSEMKREISARQFIYVVVIYLSFFLYIGTSYIMVHSLLPTLLKNIHGLSVE 542
>RGA3_SCHPO (O14014) Probable Rho-type GTPase-activating protein 3| Length = 969 Score = 27.3 bits (59), Expect = 8.8 Identities = 21/83 (25%), Positives = 32/83 (38%) Frame = +3 Query: 78 GNSNTLHTYTPTFQTACHAYREGKPEFPANKKVQVMLHRVAFLLGTVPNMNKIPQLLKCI 257 G+ +LH T F+ +YR P + V H+ +++ QLL Sbjct: 340 GHMRSLHNATSPFRPFSPSYRSSDTHSPRTRSPNVQTHKKT--SSQPSDLSSFAQLLSPP 397 Query: 258 HGLCVKSSGKLMNSEGKSHSLKQ 326 L K +G S SHSL + Sbjct: 398 QVLSPKPNGGGHKSFRHSHSLSE 420 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,045,157 Number of Sequences: 219361 Number of extensions: 1228568 Number of successful extensions: 2898 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2897 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)