Clone Name | rbastl39h12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GCP4_ARATH (Q9M350) Gamma-tubulin complex component 4 homolog | 29 | 3.6 | 2 | RAD50_YEAST (P12753) DNA repair protein RAD50 (EC 3.6.-.-) (153 ... | 28 | 4.7 |
---|
>GCP4_ARATH (Q9M350) Gamma-tubulin complex component 4 homolog| Length = 745 Score = 28.9 bits (63), Expect = 3.6 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -3 Query: 255 HGNH-DLQKRREDG*QGPFAQQTRKWKMEMTRLTFHIAHFLSSICISVQVD 106 H +H + + R+DG G +QQ R+ M R+ H+A + ++ +QVD Sbjct: 557 HQDHIESAQHRKDGLNGSTSQQRRQGIRPMWRVREHMAFLIRNLQFYIQVD 607
>RAD50_YEAST (P12753) DNA repair protein RAD50 (EC 3.6.-.-) (153 kDa protein)| Length = 1312 Score = 28.5 bits (62), Expect = 4.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 19 KRSTRTAILSRVKNTSNIQCKNKQKFAMLIN 111 K+ ++L +VKN +IQ +NKQK IN Sbjct: 926 KKDEAQSVLDKVKNERDIQVRNKQKTVADIN 956 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,462,697 Number of Sequences: 219361 Number of extensions: 595602 Number of successful extensions: 1168 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1168 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)