Clone Name | rbastl39h07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CHI1_APHAL (P32470) Chitinase 1 precursor (EC 3.2.1.14) | 29 | 3.5 | 2 | RFCS_PYRAB (Q9V2G4) Replication factor C small subunit (RFC smal... | 28 | 7.7 |
---|
>CHI1_APHAL (P32470) Chitinase 1 precursor (EC 3.2.1.14)| Length = 423 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 1 KQENRRASINYQAGGVSSSTINFPEDLNSALTRRCIGKSGI 123 K++NR + GG + ST NFP +SA TR+ +S + Sbjct: 116 KKQNRNMKVMLSIGGWTWST-NFPAAASSAATRKTFAQSAV 155
>RFCS_PYRAB (Q9V2G4) Replication factor C small subunit (RFC small subunit)| (Clamp loader small subunit) (PabRFC small subunit) [Contains: Pab RFC-1 intein; Pab RFC-2 intein] Length = 1437 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 128 FKPQLSLQYNNNYYCIKELKHYLRSGKMGH 217 ++PQ + + +K LKHY+++G M H Sbjct: 21 YRPQKLEEIVGQEHIVKRLKHYVKTGSMPH 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,832,295 Number of Sequences: 219361 Number of extensions: 659968 Number of successful extensions: 1581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1581 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)