Clone Name | rbastl39g03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | COPG_BOVIN (P53620) Coatomer subunit gamma (Gamma-coat protein) ... | 29 | 4.9 | 2 | BLNK_RAT (Q4KM52) B-cell linker protein (Cytoplasmic adapter pro... | 28 | 8.4 | 3 | ATX1_MOUSE (P54254) Ataxin-1 (Spinocerebellar ataxia type 1 prot... | 28 | 8.4 |
---|
>COPG_BOVIN (P53620) Coatomer subunit gamma (Gamma-coat protein) (Gamma-COP)| Length = 874 Score = 29.3 bits (64), Expect = 4.9 Identities = 21/86 (24%), Positives = 36/86 (41%), Gaps = 1/86 (1%) Frame = -1 Query: 406 PAIWAMQWALSPPKAILEAPKVNLMDRIHVSPQAVRAVSEIGIRKIAPD-NRCIPSSTFQ 230 PA+ +Q S PKA L V ++++ + + + + + D NR I + Sbjct: 287 PAVSVLQLFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDANRSIATLAIT 346 Query: 229 CEC*PRKEGNV*RLMSRSCYFSSGFS 152 EG++ RLM + F S S Sbjct: 347 TLLKTGSEGSIDRLMKQISSFMSEIS 372
>BLNK_RAT (Q4KM52) B-cell linker protein (Cytoplasmic adapter protein)| Length = 457 Score = 28.5 bits (62), Expect = 8.4 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 8/88 (9%) Frame = -2 Query: 327 EYMYPLKQSEQSVR*VFERSPLITDVFPAPRSSVNANHGKK-VTCND**AGH-------V 172 +Y+ P++ ++++ E SPL + P S N K V+ AG Sbjct: 177 DYVVPVEDNDENYIHPRESSPLPAEKAPTVNRSTKPNSSSKHVSPPGTVAGRNSGVWDSK 236 Query: 171 IFLPASPCPLPRSSGVQVFSPLQSEGTP 88 LPA+P PLPR +G + +PL++ P Sbjct: 237 SSLPAAPSPLPR-AGKKTATPLKTTPVP 263
>ATX1_MOUSE (P54254) Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)| Length = 792 Score = 28.5 bits (62), Expect = 8.4 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +1 Query: 298 LGLLEGIHVFCPSGLPSVPQESPLGVTMPTALPK*QEAACIPATCNAHL 444 +GLL+ + PS P+ P T+PT P Q + AHL Sbjct: 74 MGLLKALSAGLDYSPPSAPRSVPTANTLPTVYPPPQSGTPVSPVQYAHL 122 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,570,293 Number of Sequences: 219361 Number of extensions: 1548953 Number of successful extensions: 3948 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3948 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)