Clone Name | rbastl39f09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HIRA_FUGRU (O42611) HIRA protein (TUP1-like enhancer of split pr... | 30 | 3.2 | 2 | PGPB_HAEIN (P44570) Phosphatidylglycerophosphatase B (EC 3.1.3.27) | 29 | 5.4 | 3 | TYSY_METCA (Q603S2) Thymidylate synthase (EC 2.1.1.45) (TS) (TSase) | 28 | 7.1 | 4 | IF2_LACPL (Q88VK7) Translation initiation factor IF-2 | 28 | 9.2 |
---|
>HIRA_FUGRU (O42611) HIRA protein (TUP1-like enhancer of split protein 1)| Length = 1025 Score = 29.6 bits (65), Expect = 3.2 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -1 Query: 198 PSTPLPVVGPNDVVAVTCKHVLASVCSSCTRIL 100 PS+ L G +DVVAV + + SV SSC R L Sbjct: 743 PSSVLTAAGSSDVVAVASQDRMLSVFSSCGRRL 775
>PGPB_HAEIN (P44570) Phosphatidylglycerophosphatase B (EC 3.1.3.27)| Length = 241 Score = 28.9 bits (63), Expect = 5.4 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = +1 Query: 40 PRVYSLYTEKRCGSTPD*LLQNPCTRRANASKNMFTRNS 156 PR +++Y ++ STP+ +N T RA +KN ++ ++ Sbjct: 100 PRPFTVYLAEQTHSTPENFYKNDRTLRAEIAKNFYSMDA 138
>TYSY_METCA (Q603S2) Thymidylate synthase (EC 2.1.1.45) (TS) (TSase)| Length = 260 Score = 28.5 bits (62), Expect = 7.1 Identities = 16/60 (26%), Positives = 21/60 (35%), Gaps = 8/60 (13%) Frame = +1 Query: 181 RQWRAWSAIFDPIDAFA*FSRERPAAAR--------CSLEH*SFPPCSPRLSCQARQTRL 336 RQWR W+ D + R P + R L+ + PPC C RL Sbjct: 96 RQWRNWNGAIDQLAGLVEQLRRNPGSRRLLVSAWNPSDLDAMALPPCHYAFQCHVADGRL 155
>IF2_LACPL (Q88VK7) Translation initiation factor IF-2| Length = 858 Score = 28.1 bits (61), Expect = 9.2 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 216 RVKDCAPSTPLPVVGPNDV 160 R+K+ PSTP+ + G NDV Sbjct: 586 RIKEAVPSTPIEITGLNDV 604 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,346,493 Number of Sequences: 219361 Number of extensions: 822440 Number of successful extensions: 2323 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2323 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)