Clone Name | rbastl39f03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ARGC_XYLFT (Q87EL1) N-acetyl-gamma-glutamyl-phosphate reductase ... | 30 | 3.2 | 2 | ARGC_XYLFA (Q9PEM6) N-acetyl-gamma-glutamyl-phosphate reductase ... | 29 | 5.4 | 3 | GLND_NITWN (Q3SWE0) [Protein-PII] uridylyltransferase (EC 2.7.7.... | 29 | 5.4 | 4 | YHCT_BACSU (P54604) Hypothetical RNA pseudouridine synthase yhcT... | 29 | 7.1 | 5 | GRC3_ASPFU (Q4WID9) Protein grc3 | 29 | 7.1 |
---|
>ARGC_XYLFT (Q87EL1) N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)| (AGPR) (N-acetyl-glutamate semialdehyde dehydrogenase) (NAGSA dehydrogenase) Length = 327 Score = 30.0 bits (66), Expect = 3.2 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 179 VSLT*NLWLNQMFHRQHTFRIYTTDFGSQPI 271 ++LT NLWL + R+H +Y T + + P+ Sbjct: 219 ITLTANLWLQRPLTREHIKTLYATRYANDPL 249
>ARGC_XYLFA (Q9PEM6) N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)| (AGPR) (N-acetyl-glutamate semialdehyde dehydrogenase) (NAGSA dehydrogenase) Length = 333 Score = 29.3 bits (64), Expect = 5.4 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 179 VSLT*NLWLNQMFHRQHTFRIYTTDFGSQPI 271 ++LT NLWL + R+H +Y T + + P+ Sbjct: 219 ITLTANLWLQRPLTREHIKILYATRYANDPL 249
>GLND_NITWN (Q3SWE0) [Protein-PII] uridylyltransferase (EC 2.7.7.59) (PII| uridylyl-transferase) (Uridylyl-removing enzyme) (UTase) Length = 925 Score = 29.3 bits (64), Expect = 5.4 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 163 EDRIHRVLDMKPVVKPNVS*ATY-LQDLHNRFWFSTY 270 E+R HR + +V+PNV L+DLH FW + Y Sbjct: 222 EERHHRAGQSRYLVEPNVKDGKGGLRDLHTLFWIAKY 258
>YHCT_BACSU (P54604) Hypothetical RNA pseudouridine synthase yhcT (EC 5.4.99.-)| (RNA-uridine isomerase) (RNA pseudouridylate synthase) Length = 302 Score = 28.9 bits (63), Expect = 7.1 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -2 Query: 331 VLLQRLLVNRMGRVYTVIKFNRLRTKIGCVNP 236 +L Q+L + R YT I +LRTK G +NP Sbjct: 156 ILDQQLEKKTLKRTYTAIAEGKLRTKKGTINP 187
>GRC3_ASPFU (Q4WID9) Protein grc3| Length = 455 Score = 28.9 bits (63), Expect = 7.1 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 304 CLPIVFARAQTIFKMVEPLCVPRNDLTANKLRDYLQSCVAITTGAKILDNPNWGTS 471 CL + R+ + L P + A+KLRD L+ I +LDNP+W S Sbjct: 307 CLGLALVRSIDVPSRKLELITP---IPASKLRDALEQGHGIVLVRGMLDNPSWAIS 359 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,753,541 Number of Sequences: 219361 Number of extensions: 1347057 Number of successful extensions: 2427 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2427 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)