Clone Name | rbastl39e11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HIS52_METMP (P61783) Imidazole glycerol phosphate synthase subun... | 28 | 5.3 |
---|
>HIS52_METMP (P61783) Imidazole glycerol phosphate synthase subunit hisH2 (EC| 2.4.2.-) (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit hisH2) (ImGP synthase subunit hisH2) (IGPS subunit hisH2) Length = 202 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 1 GKCRSVHMVLAPTMQNRKLGLSLFRSKATKKKIANRFR 114 G C +H++ + + R GL +K K K++N+F+ Sbjct: 78 GICLGMHLLTNSSEEGRLKGLGFINAKTVKFKLSNKFK 115 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,567,092 Number of Sequences: 219361 Number of extensions: 213445 Number of successful extensions: 600 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 600 length of database: 80,573,946 effective HSP length: 24 effective length of database: 75,309,282 effective search space used: 1807422768 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)