| Clone Name | rbastl39d08 |
|---|---|
| Clone Library Name | barley_pub |
>ARI1B_HUMAN (Q8NFD5) AT-rich interactive domain-containing protein 1B (ARID| domain-containing protein 1B) (Osa homolog 2) (hOsa2) (p250R) (BRG1-binding protein hELD/OSA1) (BRG1-associated factor 250b) (BAF250B) Length = 2236 Score = 31.2 bits (69), Expect = 1.0 Identities = 21/48 (43%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = +2 Query: 281 PSIHHYGRQGGPTTAEPSP----KAQEAAAS-CRAWTGAAASQQGGSP 409 PS +QGGP P P KAQEAAA+ +A +A S+QG P Sbjct: 905 PSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSRQGSFP 952
>MTSS1_HUMAN (O43312) Metastasis suppressor protein 1 (Missing in metastasis| protein) (Metastasis suppressor YGL-1) Length = 755 Score = 29.6 bits (65), Expect = 3.0 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +2 Query: 308 GGPTTAEPSPKAQEAAASCRAWTGAAASQQG 400 GGPTTA P A E A R+ T +AA++ G Sbjct: 440 GGPTTASGPPAAAEEAQRPRSMTVSAATRPG 470
>RLUB_XANAC (Q8PK58) Ribosomal large subunit pseudouridine synthase B (EC| 5.4.99.-) (rRNA-uridine isomerase B) (rRNA pseudouridylate synthase B) Length = 550 Score = 29.3 bits (64), Expect = 3.9 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = +2 Query: 281 PSIHHYGRQGGPTTAEPSPKAQEAAASCRAWTGAAASQQGGSPTR 415 PS H GP T + P A++ R TG + G P R Sbjct: 397 PSGHRNAGPSGPGTGQARPYAKKGPGGARPGTGGPVGARSGGPGR 441
>OVO_DROME (P51521) Protein ovo (Protein shaven baby)| Length = 1351 Score = 28.9 bits (63), Expect = 5.2 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +2 Query: 254 REQQAP*IHPSIHHYGRQGGPTTAEPSPKAQEAAASCRAWTGAAAS 391 ++Q P H S HH + PSP A AAA+ A AAA+ Sbjct: 972 QQQPQPQSHHSHHHGHGHDNSNMSLPSPTAAAAAAAAAAAAAAAAA 1017
>ACK1_HUMAN (Q07912) Activated CDC42 kinase 1 (EC 2.7.10.2) (ACK-1) (Tyrosine| kinase non-receptor protein 2) Length = 1036 Score = 28.9 bits (63), Expect = 5.2 Identities = 24/83 (28%), Positives = 29/83 (34%), Gaps = 13/83 (15%) Frame = +2 Query: 185 VRVSVHACLDPNRNNFTNN*QLAREQQAP*IHPSIHHYGRQG-GPTTAEPSPKAQ----- 346 VR A LDP N TNN P + G G GP P+ K Q Sbjct: 907 VRPMPQAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPGDGPEAGRPADKIQMAMVH 966 Query: 347 -------EAAASCRAWTGAAASQ 394 +AA C W+ A+Q Sbjct: 967 GVTTEECQAALQCHGWSVQRAAQ 989
>TRUD_HALSA (Q9HSG5) Probable tRNA pseudouridine synthase D (EC 5.4.99.-)| (tRNA-uridine isomerase D) (tRNA pseudouridylate synthase D) Length = 434 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +2 Query: 308 GGPTTAEP--SPKAQEAAASCRAWTGAAA 388 G PT EP S +A+E A R WTGA A Sbjct: 207 GAPTEHEPADSQRAREYVAETRDWTGALA 235 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,378,890 Number of Sequences: 219361 Number of extensions: 724024 Number of successful extensions: 1871 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1868 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)