Clone Name | rbastl39d05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VGNM_BPMV (P23009) Genome polyprotein M (RNA2 polyprotein) [Cont... | 30 | 3.0 | 2 | VGNB_BPMV (Q9YJU5) Genome polyprotein B (RNA1 polyprotein) [Cont... | 28 | 6.7 |
---|
>VGNM_BPMV (P23009) Genome polyprotein M (RNA2 polyprotein) [Contains:| Movement protein (MP); Large coat protein (LCP) (Coat protein VP37); Small coat protein (SCP) (Coat protein VP23)] Length = 1018 Score = 29.6 bits (65), Expect = 3.0 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +2 Query: 203 NKPLSQLEKQASWEENCLVVQTVYIGD 283 N P+S L + A+W++ CL+V+ V G+ Sbjct: 873 NSPISNLLRVAAWKKGCLMVKVVMSGN 899
>VGNB_BPMV (Q9YJU5) Genome polyprotein B (RNA1 polyprotein) [Contains:| Protease cofactor (32 kDa protein); Putative helicase (EC 3.6.1.-) (NTP-binding protein) (NTB) (Membrane-binding protein) (58 kDa protein); Viral genome-linked protein (VPg); Picornain Length = 1850 Score = 28.5 bits (62), Expect = 6.7 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = +3 Query: 117 LVSNCALPWSQHINHSQPNRSMLVRDATEINHFHSLR 227 L+++C W +H+ + N S + +E HF++ + Sbjct: 640 LLAHCFTKWERHVKEQESNLSQIKGKKSESGHFYNFQ 676 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,551,754 Number of Sequences: 219361 Number of extensions: 978111 Number of successful extensions: 2089 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2089 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)