| Clone Name | rbastl39c07 |
|---|---|
| Clone Library Name | barley_pub |
>DRP2B_ARATH (Q9LQ55) Dynamin-2B (EC 3.6.5.5) (Dynamin-related protein 2B)| (Dynamin-like protein 3) Length = 920 Score = 34.3 bits (77), Expect = 0.14 Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -2 Query: 435 DANGANSGSRRT-PNRLPPAPPK 370 D++G+ SRRT PNRLPPAPP+ Sbjct: 891 DSSGSGGSSRRTTPNRLPPAPPQ 913
>DRP2A_ARATH (Q9SE83) Dynamin-2A (EC 3.6.5.5) (Dynamin-related protein 2A)| (Dynamin-like protein 6) Length = 914 Score = 32.7 bits (73), Expect = 0.41 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 426 GANSGSRRTPNRLPPAPP 373 G+ S R TPNRLPPAPP Sbjct: 889 GSGSNRRTTPNRLPPAPP 906
>LACR_STAXY (O33813) Lactose operon transcription activator| Length = 279 Score = 30.8 bits (68), Expect = 1.6 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = +2 Query: 194 YITYIFL*TTEVLWIHT---IHAISRQLSILHPSLFSHQYHKGVRACHEKYDSHIA 352 Y+TYI + L IHT I ISRQ+ P LFS + K +Y H + Sbjct: 219 YLTYIRMYHASQLLIHTSTLISDISRQVGYKDPLLFSKNFTKHFEISASEYRHHFS 274
>EXOC2_RAT (O54921) Exocyst complex component 2 (Exocyst complex component| Sec5) (rSec5) Length = 924 Score = 30.8 bits (68), Expect = 1.6 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 3/92 (3%) Frame = -3 Query: 377 RRNTKDVDWQCENHIFHGMLSLPCDIDGKTDWDEE*RAGE---RSHEWCVSRGPQLFIEI 207 +R + DW +N G+ SLPC + + G + E V + P+ E+ Sbjct: 599 KRLAEKEDWIVDNE---GLTSLPCQFEQSIVHSLQSLKGVVDCKPGEASVFQQPKTQEEV 655 Query: 206 CRLCMVIVTRSFYYIDQSDALSACEILLPHIS 111 C+LC+ I+ Y ++Q +I H+S Sbjct: 656 CQLCISIMQVFIYCLEQLSTKPDADIDTTHLS 687
>EXOC2_MOUSE (Q9D4H1) Exocyst complex component 2 (Exocyst complex component| Sec5) Length = 924 Score = 30.8 bits (68), Expect = 1.6 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 3/92 (3%) Frame = -3 Query: 377 RRNTKDVDWQCENHIFHGMLSLPCDIDGKTDWDEE*RAGE---RSHEWCVSRGPQLFIEI 207 +R + DW +N G+ SLPC + + G + E V + P+ E+ Sbjct: 599 KRLAEKEDWVVDNE---GLTSLPCQFEQSIVHSLQSLKGVVDCKPGEASVFQQPKTQEEV 655 Query: 206 CRLCMVIVTRSFYYIDQSDALSACEILLPHIS 111 C+LC+ I+ Y ++Q +I H+S Sbjct: 656 CQLCINIMQVFIYCLEQLSTKPDADIDTTHLS 687
>YKR6_YEAST (P34239) Hypothetical 93.4 kDa protein in STE3-GIN10 intergenic| region Length = 828 Score = 29.3 bits (64), Expect = 4.5 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 4/35 (11%) Frame = -3 Query: 194 MVIVTRSFYYIDQSD--ALSAC--EILLPHIS*SW 102 +V++TR FYY Q + A+S C ILLP ++ SW Sbjct: 187 LVLITRIFYYTHQYNRIAISLCIPRILLPVVAESW 221
>YMER_STAAU (P08655) Hypothetical 19.7 kDa protein in mercuric resistance| operon Length = 180 Score = 29.3 bits (64), Expect = 4.5 Identities = 9/30 (30%), Positives = 21/30 (70%) Frame = -3 Query: 440 NGTPMVPIQAADAHQIGCHLHRRNTKDVDW 351 +G P+ P+ +AD+H + +L + N+K +++ Sbjct: 39 DGLPLTPVASADSHVVASNLLKGNSKKIEY 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,393,451 Number of Sequences: 219361 Number of extensions: 1332238 Number of successful extensions: 3043 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3043 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)