| Clone Name | rbastl39b11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LYST_HUMAN (Q99698) Lysosomal trafficking regulator (Beige homolog) | 28 | 5.9 | 2 | LYST_MOUSE (P97412) Lysosomal trafficking regulator (Beige prote... | 28 | 5.9 | 3 | FBX27_HUMAN (Q8NI29) F-box only protein 27 (F-box/G-domain prote... | 28 | 5.9 | 4 | FBX27_MACFA (Q9N0C8) F-box only protein 27 | 28 | 5.9 | 5 | VG71_SHV21 (Q01044) Hypothetical gene 71 protein | 28 | 7.7 |
|---|
>LYST_HUMAN (Q99698) Lysosomal trafficking regulator (Beige homolog)| Length = 3801 Score = 28.1 bits (61), Expect = 5.9 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = -2 Query: 223 ERTAPNHEEREELNVATAAISNCIKSSFLCLFEMANCTCRAVSCR*ESSTLLKMIL 56 +R EE EE ++AT FL L ++ + +A++CR E TLL +L Sbjct: 25 QRVEAREEEEEETHMATLGQYLVHGRGFLLLTKLNSIIDQALTCREELLTLLLSLL 80
>LYST_MOUSE (P97412) Lysosomal trafficking regulator (Beige protein) (CHS1| homolog) Length = 3788 Score = 28.1 bits (61), Expect = 5.9 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = -2 Query: 223 ERTAPNHEEREELNVATAAISNCIKSSFLCLFEMANCTCRAVSCR*ESSTLLKMIL 56 +R EE EE ++AT FL L ++ + +A++CR E TLL +L Sbjct: 25 QRAEAREEEEEETHMATLGQYLVHGRGFLLLTKLNSIIDQALTCREELLTLLLSLL 80
>FBX27_HUMAN (Q8NI29) F-box only protein 27 (F-box/G-domain protein 5)| Length = 283 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 8/43 (18%) Frame = -1 Query: 293 KNWRALIFGPQIWLMALNPSH--------QWRKNCSEPRRTRR 189 + WRAL+ G +WL+ L H ++C P R R Sbjct: 55 RGWRALVDGQALWLLILARDHGATGRALLHLARSCQSPARNAR 97
>FBX27_MACFA (Q9N0C8) F-box only protein 27| Length = 280 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 8/43 (18%) Frame = -1 Query: 293 KNWRALIFGPQIWLMALNPSH--------QWRKNCSEPRRTRR 189 + WRAL+ G +WL+ L H ++C P R R Sbjct: 57 RGWRALVDGQALWLLILARDHSATGRALLHLARSCQSPARNAR 99
>VG71_SHV21 (Q01044) Hypothetical gene 71 protein| Length = 167 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 184 NVATAAISNCIKSSFLCLFEMANCTCRAVSC 92 NVA ++ C+ S+ LC + C C+ C Sbjct: 124 NVAAPSVILCVFSNMLCEMHVLECLCQLKKC 154 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,209,014 Number of Sequences: 219361 Number of extensions: 650500 Number of successful extensions: 1638 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1638 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)