Clone Name | rbastl39b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RSE1_KLULA (Q6CXH8) Pre-mRNA-splicing factor RSE1 | 29 | 3.2 | 2 | VGLP_BEV (P23052) Peplomer glycoprotein precursor | 28 | 5.5 |
---|
>RSE1_KLULA (Q6CXH8) Pre-mRNA-splicing factor RSE1| Length = 1269 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 131 SSGI*RCLYLLDVIIQCYMHLTPSFYELVNYV 36 +S I C Y L+ + YM+ TP +E+VN++ Sbjct: 1086 ASNIKACQYTLETLCHMYMNDTPMKFEIVNHM 1117
>VGLP_BEV (P23052) Peplomer glycoprotein precursor| Length = 1581 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 159 TVCYLKPLCLQWHLEMFVPS*CHNSVLYAPDAIF 58 T+C+ P FV C+N+ LY PDA+F Sbjct: 334 TLCFGSPF--------FVAQECYNNALYLPDAVF 359 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,873,428 Number of Sequences: 219361 Number of extensions: 874989 Number of successful extensions: 2106 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2077 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2106 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)