Clone Name | rbastl39a03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NOP14_SCHPO (O43051) Probable nucleolar complex protein 14 | 30 | 3.7 |
---|
>NOP14_SCHPO (O43051) Probable nucleolar complex protein 14| Length = 827 Score = 29.6 bits (65), Expect = 3.7 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 7/108 (6%) Frame = +3 Query: 102 KHVLNTETKPRDQHSILCHQSEPLHSISKQGPSLSHGSY-------SKRLRQTSAPPAIS 260 +H+L+ +P +L H +E LHS+++Q PS S+ KRL ++ P I Sbjct: 463 QHILHLTRQPMISMELLEHLTEHLHSLAQQFPSALGISFISVVEGMRKRLAKSYVYPEIK 522 Query: 261 IGGGNISTAFCKISNYPFKGSSTFSLHVTRMVSVIVTSPVVKIVRGSI 404 F +IS+ F + T S+ T IV SPV+ + S+ Sbjct: 523 ---------FPEISDLLF-FNLTGSIFPTSDKKHIVVSPVMLTMAESL 560 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,304,119 Number of Sequences: 219361 Number of extensions: 1318316 Number of successful extensions: 3631 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3631 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)