Clone Name | rbastl39a02 |
---|---|
Clone Library Name | barley_pub |
>CFA_ECOLI (P0A9H7) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) Length = 381 Score = 36.2 bits (82), Expect = 0.036 Identities = 19/50 (38%), Positives = 30/50 (60%) Frame = -3 Query: 436 WRDNFMINKDEILALGFDDKFMRIWEYYLIFSASCFKSRTLGDYQVVFSR 287 W + F+ EI A + ++F R++ YYL A F++R + +QVVFSR Sbjct: 323 WYERFLAAWPEI-ADNYSERFKRMFTYYLNACAGAFRARDIQLWQVVFSR 371
>CFA_ECOL6 (P0A9H8) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) Length = 381 Score = 36.2 bits (82), Expect = 0.036 Identities = 19/50 (38%), Positives = 30/50 (60%) Frame = -3 Query: 436 WRDNFMINKDEILALGFDDKFMRIWEYYLIFSASCFKSRTLGDYQVVFSR 287 W + F+ EI A + ++F R++ YYL A F++R + +QVVFSR Sbjct: 323 WYERFLAAWPEI-ADNYSERFKRMFTYYLNACAGAFRARDIQLWQVVFSR 371
>RYR2_RABIT (P30957) Ryanodine receptor 2 (Cardiac muscle-type ryanodine| receptor) (RyR2) (RYR-2) (Cardiac muscle ryanodine receptor-calcium release channel) Length = 4969 Score = 32.3 bits (72), Expect = 0.52 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = -1 Query: 342 LRLASSHEHLEITRLFSLVQATVG*PCLDSRQISLSVQLSN 220 L++ S+HEH+E+TR+ + ++ PCL Q S Q SN Sbjct: 1259 LQVPSNHEHIEVTRIDGTIDSS---PCLKVTQKSFGSQNSN 1296
>RYR2_HUMAN (Q92736) Ryanodine receptor 2 (Cardiac muscle-type ryanodine| receptor) (RyR2) (RYR-2) (Cardiac muscle ryanodine receptor-calcium release channel) (hRYR-2) Length = 4967 Score = 32.3 bits (72), Expect = 0.52 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = -1 Query: 342 LRLASSHEHLEITRLFSLVQATVG*PCLDSRQISLSVQLSN 220 L++ S+HEH+E+TR+ + ++ PCL Q S Q SN Sbjct: 1259 LQVPSNHEHIEVTRIDGTIDSS---PCLKVTQKSFGSQNSN 1296
>CFA_CITFR (P45509) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) (Fragment) Length = 89 Score = 30.8 bits (68), Expect = 1.5 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = -3 Query: 436 WRDNFMINKDEILALGFDDKFMRIWEYYLIFSASCFKSRTLGDYQVVFSR 287 W + F E L+ + F R++ YYL A F++R + +QV+FSR Sbjct: 31 WHERFNQAWPE-LSSRYSATFRRMFNYYLCACAGAFRARDIELWQVLFSR 79
>DSG1A_MOUSE (Q61495) Desmoglein-1 alpha precursor (Dsg1-alpha) (Desmoglein-1)| (Desmosomal glycoprotein I) (DG1) (DGI) Length = 1057 Score = 30.8 bits (68), Expect = 1.5 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 216 NGSIAERTRISDGYQGTASRRLPGREKTTW 305 +GS +R R+++GYQGT+S P R +W Sbjct: 499 SGSGDDRDRVTNGYQGTSSTENPQRVTGSW 528
>MUTS_AQUPY (P70755) DNA mismatch repair protein mutS| Length = 855 Score = 29.3 bits (64), Expect = 4.4 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +1 Query: 148 KIIGKYVEITKAKVEQASNYKRLMVR*LNGQGYLTAIKARLADGCLDERKQPGNLQ 315 K++G Y+E+TKA V+ + R N + Y T RL + L + + L+ Sbjct: 463 KVMGYYIEVTKANVKYVPEHFRRRQTLSNAERYTTEELQRLEEKILSAQTRINELE 518
>STX3_CAEEL (Q20797) Putative syntaxin-3| Length = 413 Score = 28.5 bits (62), Expect = 7.6 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = +1 Query: 76 GIRHKSTHILGWFVSSPLQFHQGTKIIGKYVEITKAKVEQASNYKR 213 GIR + H + +S +QF+Q K IGK + T AK+E+ + Y + Sbjct: 131 GIRPQPKHEM---LSESVQFNQLAKRIGKELSQTCAKMEKLAEYAK 173
>RECA_LACPE (Q6KCK3) Protein recA (Recombinase A)| Length = 378 Score = 28.1 bits (61), Expect = 9.9 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 130 QFHQGTKIIGKYVEITKAKVEQASNYKRLMVR*LNGQG 243 Q +GT IIG V I K + A +KR V + GQG Sbjct: 229 QIKEGTNIIGNRVRIKVVKNKVAPPFKRAEVDIMYGQG 266
>RECA_LACPL (Q88UZ4) Protein recA (Recombinase A)| Length = 380 Score = 28.1 bits (61), Expect = 9.9 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 130 QFHQGTKIIGKYVEITKAKVEQASNYKRLMVR*LNGQG 243 Q +GT IIG V I K + A +KR V + GQG Sbjct: 229 QIKEGTNIIGNRVRIKVVKNKVAPPFKRAEVDIMYGQG 266
>DNBI_HHV1K (P17470) Major DNA-binding protein (Infected cell protein 8) (ICP 8| protein) Length = 1196 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 32 NKDTIPCNVCTEHKRASGIKVHTSLAGLSAAH 127 N+ +PCN+CT R + VHT+L L A H Sbjct: 493 NQTDVPCNLCTFDTRHA--CVHTTLMRLRARH 522
>DNBI_HHV1F (P17469) Major DNA-binding protein (Infected cell protein 8) (ICP 8| protein) Length = 1196 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 32 NKDTIPCNVCTEHKRASGIKVHTSLAGLSAAH 127 N+ +PCN+CT R + VHT+L L A H Sbjct: 493 NQTDVPCNLCTFDTRHA--CVHTTLMRLRARH 522
>DNBI_HHV11 (P04296) Major DNA-binding protein (Infected cell protein 8) (ICP 8| protein) Length = 1196 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 32 NKDTIPCNVCTEHKRASGIKVHTSLAGLSAAH 127 N+ +PCN+CT R + VHT+L L A H Sbjct: 493 NQTDVPCNLCTFDTRHA--CVHTTLMRLRARH 522 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,341,522 Number of Sequences: 219361 Number of extensions: 1215246 Number of successful extensions: 2751 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2692 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2751 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)