Clone Name | rbastl38g05 |
---|---|
Clone Library Name | barley_pub |
>AMGO1_MOUSE (Q80ZD8) Amphoterin-induced protein 1 precursor (Alivin-2)| Length = 492 Score = 33.1 bits (74), Expect = 0.35 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 7/58 (12%) Frame = +2 Query: 59 SMPRRRGDLTFP-------GIYTCPSMGALQTWSSSADLQIYNLTKMGENNGRRHIFT 211 S+ R GDL F G+YTC +MG + S +L++YN T G ++ +T Sbjct: 317 SVSVRNGDLFFKKVQVEDGGVYTCYAMGETFNETLSVELKVYNFTLHGHHDTLNTAYT 374
>AMGO1_RAT (Q80ZD7) Amphoterin-induced protein 1 precursor (Alivin-2)| Length = 493 Score = 30.4 bits (67), Expect = 2.3 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +2 Query: 95 GIYTCPSMGALQTWSSSADLQIYNLTKMGENNGRRHIFT 211 G+YTC +MG + S +L++YN T G ++ +T Sbjct: 337 GVYTCYAMGETFNETLSVELKVYNFTLHGHHDTLNTAYT 375
>ADPGK_MOUSE (Q8VDL4) ADP-dependent glucokinase (EC 2.7.1.147) (ADPGK) (ADP-GK)| Length = 496 Score = 29.3 bits (64), Expect = 5.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 66 QEEEETSLFPEYTLAHQWGPYK 131 QEE+E L EY +WGP+K Sbjct: 201 QEEDEFHLILEYLAGEEWGPFK 222
>TTBK2_HUMAN (Q6IQ55) Tau-tubulin kinase 2 (EC 2.7.11.1)| Length = 1244 Score = 29.3 bits (64), Expect = 5.0 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +1 Query: 61 HAKKKRRPHFSRNIHLPINGGPTNLEFICRSADLQPDENG*K*WQKTHFYSAT 219 H ++ PH R+ P + G ++ C+ +P +NG K H +SA+ Sbjct: 1176 HDQRSSSPHLGRSKSPPSHSGSSSSRRSCQQEHCKPSKNGLKGSGSLHHHSAS 1228
>PSL2_MOUSE (Q9JJF9) Signal peptide peptidase-like 2A (EC 3.4.23.-) (SPP-like| 2A protein) (SPPL2a protein) (Intramembrane protease 3) (IMP3) (Presenilin-like protein 2) Length = 523 Score = 28.9 bits (63), Expect = 6.6 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Frame = -3 Query: 216 CTVKMCLLPLFSPIFVRL*--ICRSADELQV--CRAPIDGQVYIPGKVRSPLLLGMEVKY 49 C + + LL ++ FV + I ++ + + V P + +P +R P L+G V Sbjct: 344 CVILLGLLLIYDVFFVFITPFITKNGESIMVELAAGPFENAEKLPVVIRVPKLMGYSVMS 403 Query: 48 RCNVKLSFIHYSD 10 C+V +S + + D Sbjct: 404 VCSVPVSVLGFGD 416
>AMGO1_HUMAN (Q86WK6) Amphoterin-induced protein 1 precursor (Alivin-2)| Length = 493 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 95 GIYTCPSMGALQTWSSSADLQIYNLTKMGENNGRRHIFT 211 G+YTC +MG + S +L+++N T G ++ +T Sbjct: 337 GVYTCYAMGETFNETLSVELKVHNFTLHGHHDTLNTAYT 375
>GBLP_MEDSA (O24076) Guanine nucleotide-binding protein beta subunit-like| protein Length = 325 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 Query: 366 HSGWPSA*RSSPSTPQP 416 HS W S R SPSTPQP Sbjct: 148 HSDWVSCVRFSPSTPQP 164
>HEM6_PHOLL (Q7N6Z9) Coproporphyrinogen 3 oxidase, aerobic (EC 1.3.3.3)| (Coproporphyrinogen III oxidase, aerobic) (Coproporphyrinogenase) (Coprogen oxidase) Length = 302 Score = 28.5 bits (62), Expect = 8.6 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 307 SVFWDAGQATGLVLGAESTAILVGLPPEEARHRHHNH 417 ++ WD G GL G + +IL+ +PP AR H H Sbjct: 246 NLVWDRGTLFGLQSGGRTESILMSMPP-LARWEHDYH 281 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,866,621 Number of Sequences: 219361 Number of extensions: 1659373 Number of successful extensions: 4272 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4270 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)