Clone Name | rbastl38f09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RDGC_PASMU (P57810) Recombination-associated protein rdgC | 31 | 1.8 | 2 | TGL_BACHD (Q9K5W7) Protein-glutamine gamma-glutamyltransferase (... | 31 | 1.8 | 3 | DRS1_ASHGO (Q75F95) ATP-dependent RNA helicase DRS1 (EC 3.6.1.-) | 30 | 3.9 |
---|
>RDGC_PASMU (P57810) Recombination-associated protein rdgC| Length = 302 Score = 30.8 bits (68), Expect = 1.8 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 168 PVATGNSPNVIVTMMLHGDCTPCWALTLSEGNV 266 P++ N P+VI+T ++ D TP W + L E + Sbjct: 164 PLSFANEPSVIMTDWINKDQTPAWLMPLEEAEL 196
>TGL_BACHD (Q9K5W7) Protein-glutamine gamma-glutamyltransferase (EC 2.3.2.13)| (Transglutaminase) (TGase) Length = 284 Score = 30.8 bits (68), Expect = 1.8 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +3 Query: 111 YSHFNFTKFEINKRGTTTSPVATGNSPNVIVTMMLHGDCTP-CWALTLSEG 260 YS N +FE+N R N+ V T+ H C P W LT + G Sbjct: 41 YSSMNELRFELNVRINIMESAKEMNASQVTFTIFEHASCNPEYWTLTSTGG 91
>DRS1_ASHGO (Q75F95) ATP-dependent RNA helicase DRS1 (EC 3.6.1.-)| Length = 734 Score = 29.6 bits (65), Expect = 3.9 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +1 Query: 277 ENRNRRRIVHITTPELQLSCPVLNGTVRTNVHLPSSLQG 393 E + +VH T L LS PVL G PS +QG Sbjct: 209 EGEEAKNVVHSTFNSLSLSRPVLKGLAALGYTKPSPIQG 247 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,587,895 Number of Sequences: 219361 Number of extensions: 1464264 Number of successful extensions: 3930 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3841 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3929 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)