Clone Name | rbastl38f07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SOPB_SALDZ (Q9AH19) Inositol phosphate phosphatase sopB (EC 3.1.... | 30 | 2.7 | 2 | FXL19_MOUSE (Q6PB97) F-box/LRR-repeat protein 19 (F-box and leuc... | 30 | 2.7 | 3 | Y1330_DEIRA (Q9RUQ2) Hypothetical protein DR1330 | 29 | 7.7 |
---|
>SOPB_SALDZ (Q9AH19) Inositol phosphate phosphatase sopB (EC 3.1.3.-) (Effector| protein sopB) (Fragment) Length = 416 Score = 30.4 bits (67), Expect = 2.7 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +1 Query: 214 GRRSACLSLGLGLATAAVFHTTPARATVDGDEEPEPANNGW---WLTEFP 354 G L LG GL T+ ++ + D PE GW WL ++P Sbjct: 215 GVNELALKLGFGLKTSDSYNVEALHQLLGNDLRPEAKPGGWVGDWLAQYP 264
>FXL19_MOUSE (Q6PB97) F-box/LRR-repeat protein 19 (F-box and leucine-rich repeat| protein 19) Length = 674 Score = 30.4 bits (67), Expect = 2.7 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 280 PARATVDGDEEPEPANNGWWLTEFPLPVPKIRNSTATLP 396 P R D EE GW LTE P P P + LP Sbjct: 142 PGRRRADNGEEGANLGGGWKLTEEPPPPPPLPRRKGPLP 180
>Y1330_DEIRA (Q9RUQ2) Hypothetical protein DR1330| Length = 308 Score = 28.9 bits (63), Expect = 7.7 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 387 GGTVADLGHRQGELGEPPAVIGRLRLLVAVNGGAGGCRV 271 G +A G +GE E + GR+ L + ++ G G CRV Sbjct: 93 GRVLAQAGRWRGEALELETLAGRIPLRLVLDAGGGECRV 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,552,101 Number of Sequences: 219361 Number of extensions: 1081350 Number of successful extensions: 2675 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2675 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)