Clone Name | rbastl38f03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | INO80_NEUCR (Q872I5) Putative DNA helicase ino-80 (EC 3.6.1.-) | 30 | 2.3 | 2 | KN1_MAIZE (P24345) Homeotic protein knotted-1 | 30 | 3.9 |
---|
>INO80_NEUCR (Q872I5) Putative DNA helicase ino-80 (EC 3.6.1.-)| Length = 2001 Score = 30.4 bits (67), Expect = 2.3 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 3/61 (4%) Frame = +3 Query: 42 SYRHSAQHHYPDTRHIAHTHMIPPWTSN*SSTQTEPSIQPSLGMPLVVQ---SLELGVSG 212 S +H QHH+P+ A +PP SS Q P+I P G+ SL L G Sbjct: 176 SQQHQQQHHHPNPFVAASAPSLPPPP---SSLQAPPAITPIAGLSAPAPASGSLPLSAGG 232 Query: 213 I 215 I Sbjct: 233 I 233
>KN1_MAIZE (P24345) Homeotic protein knotted-1| Length = 359 Score = 29.6 bits (65), Expect = 3.9 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = +3 Query: 18 QHF*TCKHSYRHS-AQHHYPDTRHIAHTHMIPPWTSN*SSTQTE-PSIQPSLGMPLVVQS 191 QHF S+ H QHH+ H H PW S+ S+ P PS G+PL + + Sbjct: 6 QHFGVGASSHGHGHGQHHH-------HHHHHHPWASSLSAVVAPLPPQPPSAGLPLTLNT 58 Query: 192 L 194 + Sbjct: 59 V 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,316,973 Number of Sequences: 219361 Number of extensions: 1064679 Number of successful extensions: 3098 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3082 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)