| Clone Name | rbastl38e02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ACA13_ARATH (Q9LIK7) Putative calcium-transporting ATPase 13, pl... | 28 | 5.2 | 2 | Y06M_BPT4 (P32273) Hypothetical 12.2 kDa protein in e-segB inter... | 28 | 6.8 |
|---|
>ACA13_ARATH (Q9LIK7) Putative calcium-transporting ATPase 13, plasma| membrane-type (EC 3.6.3.8) (Ca(2+)-ATPase isoform 13) Length = 1017 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 5/52 (9%) Frame = +3 Query: 30 IILSTSKFVNSTNKRWKLFTARGYTTPTLYN-----LQTKSAFPSSMEIVAL 170 ++L K ++ +NK+W+L + Y + TL N ++ FP S+ A+ Sbjct: 19 VLLELPKTLSKSNKKWQLALIKLYCSRTLLNCAKHAIRKPGLFPRSLSYTAI 70
>Y06M_BPT4 (P32273) Hypothetical 12.2 kDa protein in e-segB intergenic region| Length = 102 Score = 28.1 bits (61), Expect = 6.8 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 129 FVDCRVWVWYILEL*ITSTFCLYYSQILKWT 37 F D +V +WYI+ L I S+F Y+ ++WT Sbjct: 72 FTDKKVLLWYIISLPI-SSFVFYFFIKIQWT 101 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,963,790 Number of Sequences: 219361 Number of extensions: 445558 Number of successful extensions: 1062 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1047 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1062 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)