Clone Name | rbastl38d09 |
---|---|
Clone Library Name | barley_pub |
>DERL1_CAEEL (Q93561) Derlin-1 (DER1-like protein 1) (cDerlin-1)| Length = 245 Score = 29.3 bits (64), Expect = 2.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 169 FWRLLVHLLYFSIKVEITFHWL 104 FWR L L+Y+ + + FHWL Sbjct: 51 FWRPLTALIYYPVTPQTGFHWL 72
>TF3A_RANPI (P34695) Transcription factor IIIA (Factor A) (TFIIIA)| Length = 335 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 113 SLVVMGIKPCTWDKPEVSLSFEVMKHLR 30 S+ G KPC D P+ LSF M +LR Sbjct: 64 SMTHTGEKPCKCDAPDCDLSFTTMTNLR 91
>MUC1_HUMAN (P15941) Mucin-1 precursor (MUC-1) (Polymorphic epithelial mucin)| (PEM) (PEMT) (Episialin) (Tumor-associated mucin) (Carcinoma-associated mucin) (Tumor-associated epithelial membrane antigen) (EMA) (H23AG) (Peanut-reactive urinary mucin) (PUM) Length = 1255 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 286 KSTPSGFVAHSQDTPPPLIAHPTK 215 KSTP +H DTP L +H TK Sbjct: 988 KSTPFSIPSHHSDTPTTLASHSTK 1011
>MUC1_HYLLA (Q29435) Mucin-1 precursor (MUC-1)| Length = 475 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 286 KSTPSGFVAHSQDTPPPLIAHPTK 215 KSTP +H DTP L +H TK Sbjct: 208 KSTPFSIPSHHSDTPTTLTSHSTK 231
>DSC2_BOVIN (P33545) Desmocollin-2 precursor (Epithelial type 2 desmocollin)| (Fragment) Length = 863 Score = 28.1 bits (61), Expect = 5.4 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 3/78 (3%) Frame = +2 Query: 110 VKGNLNFNAKVKQVNKETPKGNSNSDRRRLQSSEPFGWM---SNQGWWCVLTMSDETAGC 280 +K N+ K P+ S+S R +SS+P GW+ N G +L D A Sbjct: 432 IKENVPVGTKTIGYKAYDPETGSSSGIRYKKSSDPEGWVDVDKNSGVITILKRLDREA-- 489 Query: 281 RFLRLTTWQVSISSSEDD 334 R + +SI +S+ D Sbjct: 490 ---RSGVYNISIIASDKD 504
>Y243_ARCFU (O29996) Hypothetical protein AF0243| Length = 529 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 351 RNNQTASSSEEEIDTCHVVNRRNRHPAVSSL 259 R N A+S EE + ++NR RHP+ + L Sbjct: 299 RKNSLAASPEEVMFAIELINRYGRHPSYNGL 329
>BLAN_SERMA (P52682) Carbapenem-hydrolysing beta-lactamase Sme-1 precursor (EC| 3.5.2.6) Length = 294 Score = 27.7 bits (60), Expect = 7.1 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +2 Query: 116 GNLNFNAKVKQVNKETPKGNSNSDRRRLQSSEPFGWMSNQGWWCVLTMSDETAGC 280 GN+ NAKVK + + KGN+ D R+++S P W+ + D+T C Sbjct: 200 GNV-LNAKVKAIYQNWLKGNTTGD-ARIRASVPADWV----------VGDKTGSC 242
>LRP8_CHICK (Q98931) Low-density lipoprotein receptor-related protein 8| precursor (Apolipoprotein E receptor 2) (LR8B protein) Length = 917 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 208 RAVWLDEQSRVVVCPDYERRNRWVSISSVNNMA 306 R W+D + + C D+ NR V ISS+++++ Sbjct: 611 RLYWVDSKLHSLSCIDFNGSNREVLISSIDDLS 643
>GUAA_SYNPX (Q7UA53) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 528 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = -1 Query: 286 KSTPSGFV--AHSQDTPPPLIAHPTKRL 209 K+ P GFV AH+ +TP +AH +RL Sbjct: 145 KALPEGFVRLAHTANTPEAAVAHLQRRL 172 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,347,648 Number of Sequences: 219361 Number of extensions: 950439 Number of successful extensions: 2571 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2571 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)