Clone Name | rbastl38c10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NALP5_MOUSE (Q9R1M5) NACHT-, LRR- and PYD-containing protein 5 (... | 28 | 7.8 | 2 | Y4KT_RHISN (P55538) Hypothetical protein y4kT | 28 | 7.8 |
---|
>NALP5_MOUSE (Q9R1M5) NACHT-, LRR- and PYD-containing protein 5 (Maternal antigen| that embryos require) (Mater protein) (Ooplasm-specific protein 1) (OP1) Length = 1111 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -3 Query: 192 TYCRGARYGTRRPSRLGLFVCCCC*GACEAIVVSLCC 82 T C G + + RLGL C CEA+ +++ C Sbjct: 995 TLCEGLKQSSSSLRRLGLGACKLTSNCCEALSLAISC 1031
>Y4KT_RHISN (P55538) Hypothetical protein y4kT| Length = 516 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = -2 Query: 166 HSAALPARFVCXXXXXXXXXGYCCKPLLHLYK*HVTWPFCIC 41 H A LP R C PLLH ++ TWP C Sbjct: 144 HPALLPLRQACLVKLGAVATLPSGHPLLHSWEAWGTWPTAAC 185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.129 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,083,785 Number of Sequences: 219361 Number of extensions: 653827 Number of successful extensions: 1587 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1576 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)