Clone Name | rbastl38c04 |
---|---|
Clone Library Name | barley_pub |
>TOP2_CANAL (P87078) DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoisomerase II)| Length = 1461 Score = 30.4 bits (67), Expect = 2.2 Identities = 25/98 (25%), Positives = 40/98 (40%), Gaps = 1/98 (1%) Frame = -2 Query: 356 DRMRNNFVFFFIHSA*ETGSISNTE*AKKMWRRVM-TSNKQQGGREEAAVEEN*VQRDHT 180 D F F + E S+++ K RR T+ K Q ++ VE Sbjct: 1227 DEFLAEFDKFLLRDEQERESLASNGKKKSTKRRAKATATKDQPNNKKVKVEPK------- 1279 Query: 179 ERKNARLHTLIDYDLDNEVDACALPCPKEKQNALLFYS 66 E+K+ ++ + NE A + PKEK + L F+S Sbjct: 1280 EKKSTSAKPIVKKEASNEPQASSSSKPKEKDDILSFFS 1317
>SCNNG_XENLA (P51171) Amiloride-sensitive sodium channel gamma-subunit| (Epithelial Na+ channel gamma subunit) (Gamma ENaC) (Nonvoltage-gated sodium channel 1 gamma subunit) (SCNEG) (Gamma NaCH) Length = 660 Score = 29.3 bits (64), Expect = 4.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 449 QLGCNSKCSSSLHFRDGTIHHSLRGWICLPAD 354 +LGC S C S F++ T+ SL W L ++ Sbjct: 449 ELGCQSACRESCSFKEWTLTRSLAKWPSLNSE 480
>SCNNH_XENLA (O13263) Amiloride-sensitive sodium channel gamma-2-subunit| (Epithelial Na(+) channel gamma-2 subunit) (Gamma-2 ENAC) (Nonvoltage-gated sodium channel 1 gamma-2 subunit) (SCNEG2) (Gamma-2 NACH) Length = 663 Score = 29.3 bits (64), Expect = 4.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 449 QLGCNSKCSSSLHFRDGTIHHSLRGWICLPAD 354 +LGC S C S F++ T+ SL W L ++ Sbjct: 449 ELGCQSTCRESCSFKEWTLTRSLAKWPSLNSE 480
>PRIA_CHLTR (O84783) Primosomal protein N' (EC 3.6.1.-) (ATP-dependent helicase| priA) (Replication factor Y) Length = 753 Score = 28.9 bits (63), Expect = 6.4 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -2 Query: 188 DHTERKNARLHTLIDYDLDNEVDACAL-PCPKEKQNALLFYSLL 60 D+T ++ R+HTLI +LD++ + PC K L Y L Sbjct: 671 DYTLKETQRVHTLIKQNLDSQASLMEISPCGHFKVKDLFHYQFL 714
>LGRD_BREPA (Q70LM4) Linear gramicidin synthetase subunit D [Includes:| ATP-dependent tryptophan adenylase (TrpA) (Tryptophan activase); ATP-dependent D-leucine adenylase (D-LeuA) (D-Leucine activase); Leucine racemase [ATP-hydrolyzing] (EC 5.1.1.-); ATP-d Length = 5085 Score = 28.9 bits (63), Expect = 6.4 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 7/100 (7%) Frame = +1 Query: 97 FGHGRAHASTSLSRS*SINVCSRAFFRSVWSLWT*FSSTAASSLPPCCLLLVMTRLHIFF 276 F H RA+ T+ R+ + AF SVW +W + A LP + LV +L + Sbjct: 1690 FWHQRAYDVTATDRA--SQIAGTAFDASVWEIWPYVTKGATLYLPEEEIRLVPEKLRDWL 1747 Query: 277 AYSVFEID----PVSH---ALWMKKNTKLFLMRSAGRQIH 375 S + P++ AL +T L M + G ++H Sbjct: 1748 VASNITVSFLPTPLTESMLALEWPGDTALRYMLTGGDKLH 1787 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,222,963 Number of Sequences: 219361 Number of extensions: 1232528 Number of successful extensions: 2905 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2845 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2905 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)