Clone Name | rbastl38b11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EXOC4_ARATH (Q93YU5) Probable exocyst complex component 4 (Exocy... | 108 | 5e-24 | 2 | ALG14_DEBHA (Q6BMD0) UDP-N-acetylglucosamine transferase subunit... | 30 | 3.0 | 3 | SYIC_SCHPO (O13651) Isoleucyl-tRNA synthetase, cytoplasmic (EC 6... | 29 | 5.1 |
---|
>EXOC4_ARATH (Q93YU5) Probable exocyst complex component 4 (Exocyst complex| component Sec8) Length = 1053 Score = 108 bits (271), Expect = 5e-24 Identities = 51/81 (62%), Positives = 65/81 (80%) Frame = -2 Query: 460 ALEQALAAIPSIDSEAVQQRLDRVRTFYELLNLPFETLLGFIAEQEYLFSAKEYLSILKV 281 A+EQA+AAIP ID E VQQ LDRVRT++ELLN+PFE LL FIAE + +F+ EY ++LKV Sbjct: 973 AVEQAMAAIPYIDGETVQQNLDRVRTYFELLNMPFEALLAFIAEHDQMFTPTEYSNLLKV 1032 Query: 280 NVPGREIPMDAERRISQILGH 218 NVPGR+ P DA+ R+ +IL H Sbjct: 1033 NVPGRDTPSDAQSRLLEILSH 1053
>ALG14_DEBHA (Q6BMD0) UDP-N-acetylglucosamine transferase subunit ALG14 (EC| 2.4.1.-) (Asparagine linked glycosylation protein 14) Length = 232 Score = 30.0 bits (66), Expect = 3.0 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -2 Query: 400 LDRVRTFYELLNLP-FETLLGFIAEQEYLFSAKEYLSILKVNVPGREIPM 254 L R RT E + L F T+ I+ ++L+ ++ SIL +N PG +P+ Sbjct: 119 LHRARTVGESIILSVFSTVRSLISTIKHLYELPQFPSILLLNGPGTSVPL 168
>SYIC_SCHPO (O13651) Isoleucyl-tRNA synthetase, cytoplasmic (EC 6.1.1.5)| (Isoleucine--tRNA ligase) (IleRS) Length = 1064 Score = 29.3 bits (64), Expect = 5.1 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 11/52 (21%) Frame = -2 Query: 427 IDSEAVQQRLDRVRTFYEL-----------LNLPFETLLGFIAEQEYLFSAK 305 +D E V +R+ R++T EL L P +TL+ + +EYL AK Sbjct: 808 LDDETVLRRVKRMQTIIELARYVREQNNISLKTPLKTLIVILTNEEYLEDAK 859 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,588,865 Number of Sequences: 219361 Number of extensions: 923475 Number of successful extensions: 2336 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2334 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)