| Clone Name | rbastl38b03 |
|---|---|
| Clone Library Name | barley_pub |
>MT_PARLI (P80367) Metallothionein (MT)| Length = 65 Score = 32.0 bits (71), Expect = 0.71 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 441 PPASQTCMAFGQVLQIGASGCLFTCSAAAC-CT 346 P A Q C G+ + GAS C TCS AAC CT Sbjct: 15 PCAGQECCITGKCCKDGASVCCGTCSNAACKCT 47
>PDR1_ORYSA (Q7PC80) Probable pleiotropic drug resistance protein 1| Length = 1468 Score = 29.3 bits (64), Expect = 4.6 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 297 NPFHHFS*SVDCCPIWWAWNCTCCSSDFTVF 205 N F F S P+WW W C C +T++ Sbjct: 1373 NLFTGFVISRPATPVWWRWYCWICPVAWTLY 1403
>SODM2_HALME (O08460) Superoxide dismutase [Mn] 2 (EC 1.15.1.1) (Fragment)| Length = 146 Score = 29.3 bits (64), Expect = 4.6 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 329 LIYEGYVQQAAALHVNKHPDAPIWRTWP-NAMHVWE 433 L+Y+ +Q L V KH D +W P A+ VWE Sbjct: 94 LVYDPVTKQLRNLAVQKHNDGALWSAHPILALDVWE 129
>MTS1_STRSA (P29347) Modification methylase StsI (EC 2.1.1.72)| (Adenine-specific methyltransferase StsI) (M.StsI) Length = 653 Score = 29.3 bits (64), Expect = 4.6 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +1 Query: 43 KYMFL*TRCQAFPKNINSVLQV*HGGEKQSIHLQNSANVPFGTRDDELNRLFGY 204 KY L FPKNIN+ + + GG I+++ + F + +N +F Y Sbjct: 373 KYKLLNQILPLFPKNINTFVDIFSGGANVGINVKAKKYI-FNDMNTRINEMFRY 425
>SHBG_MOUSE (P97497) Sex hormone-binding globulin precursor (SHBG) (Sex| steroid-binding protein) (SBP) (Testis-specific androgen-binding protein) (ABP) Length = 403 Score = 28.9 bits (63), Expect = 6.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 132 NSLAKFCKCSFWNEG*RVESTLRI*RQ*NHWNNMCNSMPTIWGNNLQTS 278 +S A FC FW +G R++ + R + W + C P+ N+ +TS Sbjct: 357 SSSASFCLSDFWVQGQRLDIDQALSRSQDIWTHSCPQRPS---NDTRTS 402
>KUP_VIBCH (Q9KM59) Probable potassium transport system protein kup| Length = 620 Score = 28.9 bits (63), Expect = 6.0 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 9/103 (8%) Frame = -2 Query: 437 LLPKHA-WHSAKFSRLAHPGAYLHAVLLPAVRTLRKLGLSSEEENKLIIHFTISASL*IV 261 LL HA WH+ + R +P +H VLL TL LGL + +++ + Sbjct: 181 LLGAHAIWHAPQVLRALNPAYAVHFVLLYGQHTLFILGL---------VVLSVTGVEALY 231 Query: 260 APYGGHGI--------AHVVPVILLSLYPKSRFNSSSLVPKGT 156 A G GI A V+P +LL+ + + + + P G+ Sbjct: 232 ADMGHFGIKPIRIAWFALVMPSLLLNYFGQGAYLLTLSAPTGS 274
>SHBG_PHOSU (Q62588) Sex hormone-binding globulin precursor (SHBG) (Sex| steroid-binding protein) (SBP) (Testis-specific androgen-binding protein) (ABP) Length = 399 Score = 28.9 bits (63), Expect = 6.0 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +3 Query: 132 NSLAKFCKCSFWNEG*RVESTLRI*RQ*NHWNNMCNSMP 248 NS A FC W +G R++ + R N W + C P Sbjct: 353 NSSASFCLSDLWVQGQRLDIDQALNRSQNIWTHSCPHSP 391
>PDR3_ORYSA (Q8GU90) Pleiotropic drug resistance protein 3| Length = 1457 Score = 28.5 bits (62), Expect = 7.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 258 PIWWAWNCTCCSSDFTVF 205 PIWW W C C +T++ Sbjct: 1375 PIWWRWYCWACPVAWTLY 1392
>NIA1_ORYSA (P16081) Nitrate reductase [NADH] 1 (EC 1.7.1.1) (NR1)| Length = 916 Score = 28.5 bits (62), Expect = 7.9 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +2 Query: 314 PPMTNLIYEGYVQQAAALHVNKHPDAP--IWRTW 409 PP+ L++ G++ AA +V H P W TW Sbjct: 125 PPLAELMHHGFITPAALHYVANHGAVPRGDWSTW 158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,781,321 Number of Sequences: 219361 Number of extensions: 1445176 Number of successful extensions: 3574 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3574 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)