Clone Name | rbastl38b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MEC10_CAEEL (P34886) Degenerin mec-10 (Mechanosensory abnormalit... | 31 | 1.0 | 2 | LONM_HUMAN (P36776) Lon protease homolog, mitochondrial precurso... | 29 | 5.2 | 3 | SYA_LACPL (Q88V10) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine-... | 28 | 8.8 |
---|
>MEC10_CAEEL (P34886) Degenerin mec-10 (Mechanosensory abnormality protein 10)| Length = 724 Score = 31.2 bits (69), Expect = 1.0 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 3/73 (4%) Frame = -1 Query: 309 EKKKNRT*SCHLELRWSDPGILKSPEKPLQSLSSRRGKREAEVAKQAIICRISLTNLSKT 130 +++ N CH + +W++ E L S +++G + +E+ K+ IC SK Sbjct: 276 DRQTNDAWPCHRKEQWTNTTCQTCDEHYLCSKKAKKGTKRSELKKEPCICE------SKG 329 Query: 129 LW---HHHASILL 100 L+ H HA+++L Sbjct: 330 LFCIKHEHAAMVL 342
>LONM_HUMAN (P36776) Lon protease homolog, mitochondrial precursor (EC| 3.4.21.-) (Lon protease-like protein) (LONP) (LONHs) Length = 959 Score = 28.9 bits (63), Expect = 5.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 3 LENCESIFQQDRRYIKIIVAIPIGQYSNE 89 L+N S F R Y+ + +IP G+YSNE Sbjct: 448 LDNHSSEFNVTRNYLDWLTSIPWGKYSNE 476
>SYA_LACPL (Q88V10) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +3 Query: 39 RYIKIIVAIPIGQYSNEANGTTKLRHGGAIGFWRGLS 149 +Y KI+ + IG YS E +G T +++ +G ++ +S Sbjct: 652 KYGKIVRVVSIGDYSIEFDGGTHVKNSSELGLFKIVS 688 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,913,951 Number of Sequences: 219361 Number of extensions: 1052875 Number of successful extensions: 3498 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3498 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)