| Clone Name | rbastl38a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CWF19_SCHPO (Q09909) Cell cycle control protein cwf19 | 34 | 0.17 | 2 | SEPP1_RAT (P25236) Selenoprotein P precursor (SeP) [Contains: Se... | 32 | 0.83 | 3 | HRPX_PLALO (P04929) Histidine-rich glycoprotein precursor | 29 | 4.1 | 4 | CAUP_DROME (P54269) Homeobox protein caupolican | 29 | 5.4 | 5 | GSC_DROME (P54366) Homeobox protein goosecoid | 28 | 7.1 | 6 | ERC2_MOUSE (Q6PH08) ERC protein 2 (CAZ-associated structural pro... | 28 | 9.2 |
|---|
>CWF19_SCHPO (Q09909) Cell cycle control protein cwf19| Length = 639 Score = 33.9 bits (76), Expect = 0.17 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 282 NQTGCETFHPGTENHHHSRHGNPGHPCHFGTHRPA 386 N+T ET H HHHSRH H H + RP+ Sbjct: 16 NETDRETNHSRRHRHHHSRHRESKHGRHDRSERPS 50
>SEPP1_RAT (P25236) Selenoprotein P precursor (SeP) [Contains: Selenoprotein| Se-P10; Selenoprotein Se-P6; Selenoprotein Se-P2; Selenoprotein Se-P1] Length = 385 Score = 31.6 bits (70), Expect = 0.83 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 288 TGCETFHPGTENHHHSRHGNPGHPCHFGTHRPAQS 392 T +T P E++HH H GH H G+ +P+++ Sbjct: 193 TASKTTEPSEEHNHHKHHDKHGHE-HLGSSKPSEN 226
>HRPX_PLALO (P04929) Histidine-rich glycoprotein precursor| Length = 351 Score = 29.3 bits (64), Expect = 4.1 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +3 Query: 258 HCHPL*TRNQTGCETFHPGTENHHHSRHGNPGHPCHFGTHRPAQSLLCQHSQTSH 422 H HP E H HHH H P H H G H H H Sbjct: 79 HHHPEEHHEPHHEEHHHHHPHPHHHHHHHPPHHHHHLGHHHHHHHAAHHHHHEEH 133
>CAUP_DROME (P54269) Homeobox protein caupolican| Length = 693 Score = 28.9 bits (63), Expect = 5.4 Identities = 14/55 (25%), Positives = 20/55 (36%) Frame = +3 Query: 210 YQTSNFYRACLGSPCVHCHPL*TRNQTGCETFHPGTENHHHSRHGNPGHPCHFGT 374 Y NFY + PL Q + ++HHH H +P H G+ Sbjct: 480 YLGQNFYPPSSADQQLPHQPLQQHQQQQLQQLQQQQQHHHHPHHHHPHHSMELGS 534
>GSC_DROME (P54366) Homeobox protein goosecoid| Length = 419 Score = 28.5 bits (62), Expect = 7.1 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 312 GTENHHHSRHGNPGHPCHFGTHRPAQ 389 G +H H HG+P HP H G H Q Sbjct: 247 GHGHHPHHPHGHPHHP-HLGAHHHGQ 271
>ERC2_MOUSE (Q6PH08) ERC protein 2 (CAZ-associated structural protein 1) (CAST1)| Length = 957 Score = 28.1 bits (61), Expect = 9.2 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 297 ETFHPGTENHHHSRHGNPGHPCHFGTHRPA 386 E H +HHH H +PG H HRP+ Sbjct: 918 EDHHHYHHHHHHHHHRSPGRSQH-SNHRPS 946 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,699,466 Number of Sequences: 219361 Number of extensions: 1090030 Number of successful extensions: 3393 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3351 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)