| Clone Name | rbastl38a06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HAP1_HAEIN (P44596) Adhesion and penetration protein precursor (... | 32 | 0.37 | 2 | STE3_YEAST (P06783) Pheromone a factor receptor | 28 | 4.0 | 3 | BORG4_MOUSE (Q9JM96) Cdc42 effector protein 4 (Binder of Rho GTP... | 28 | 4.0 | 4 | Y539_AQUAE (O66818) Hypothetical protein aq_539 | 28 | 6.9 | 5 | UXAC_BACLD (Q65F21) Uronate isomerase (EC 5.3.1.12) (Glucuronate... | 28 | 6.9 |
|---|
>HAP1_HAEIN (P44596) Adhesion and penetration protein precursor (EC 3.4.21.-)| Length = 1409 Score = 32.0 bits (71), Expect = 0.37 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = +2 Query: 116 PSCLSTDC-RGEKAAMELCLTIGLRSTR*TNYFP*KWAQ-KINNRNRATVKVINALATRT 289 P+ +T C R + + C T+ L T+ N P IN N ATV + Sbjct: 708 PNXQNTICTRSDWTGLTTCKTVNLTDTKVINSIPITQINGSINLTNNATVNIHGLAKLNG 767 Query: 290 HVTAPDHSSSSMKQNSEE 343 +VT DHS ++ N+ + Sbjct: 768 NVTLIDHSQFTLSNNATQ 785
>STE3_YEAST (P06783) Pheromone a factor receptor| Length = 470 Score = 28.5 bits (62), Expect = 4.0 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +1 Query: 46 RIFNYCLSRFSSALSLLTAAWRTTVLF 126 ++F Y ++R++ +LL+ W TTVL+ Sbjct: 135 QVFRYGIARYNGCQNLLSPTWITTVLY 161
>BORG4_MOUSE (Q9JM96) Cdc42 effector protein 4 (Binder of Rho GTPases 4)| Length = 349 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 360 APSRKGSSEFCFIDEEE 310 AP R+ EFCF+DEEE Sbjct: 327 APPRQPDKEFCFMDEEE 343
>Y539_AQUAE (O66818) Hypothetical protein aq_539| Length = 285 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +1 Query: 19 FISFRIASYRIFNYCLSRFSSALSLLTAAWRTTVLFE 129 F SFRI+ +RIF YC F + L++A T+L E Sbjct: 85 FYSFRISDFRIFLYCSIPFLT-FFLISALLSNTLLEE 120
>UXAC_BACLD (Q65F21) Uronate isomerase (EC 5.3.1.12) (Glucuronate isomerase)| (Uronic isomerase) Length = 473 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 277 ESIDHLDCSPVTVVYFLRPFLGEIISSAC 191 +S+D D P T++Y L P +ISS C Sbjct: 333 DSLDRKDALPKTILYSLNPRDNVVISSLC 361 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,089,752 Number of Sequences: 219361 Number of extensions: 881140 Number of successful extensions: 1674 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1673 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)