Clone Name | rbastl33h10 |
---|---|
Clone Library Name | barley_pub |
>RGA7_SCHPO (O94466) Probable Rho-GTPase-activating protein 7| Length = 695 Score = 30.4 bits (67), Expect = 1.1 Identities = 20/63 (31%), Positives = 26/63 (41%) Frame = +1 Query: 160 PSAIPCSSTICPQLQSRFTSRLLPSLPGIGNDASTLLPKQTLDTSGSKSTLIKRPDESQQ 339 PS P S P + TS + ASTL P DT+GS S+ P S Sbjct: 374 PSTFPNPSVASPAFPNSSTSNPSTAPASASPLASTLKPSTANDTNGSSSSSSSNPRTSSP 433 Query: 340 ISS 348 ++S Sbjct: 434 LAS 436
>AHNK_HUMAN (Q09666) Neuroblast differentiation-associated protein AHNAK| (Desmoyokin) (Fragments) Length = 2960 Score = 29.6 bits (65), Expect = 1.8 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = +1 Query: 226 LPSLPGIGNDASTLLPKQTLDTSGSKSTLIKRPDESQQISSASLK 360 +PSL G G + LPK +D SG K I+ PD S + LK Sbjct: 889 MPSLKGEGPEVDVNLPKADVDVSGPKVD-IEAPDVSLEGPEGKLK 932
>MAGE1_HUMAN (Q9HCI5) Melanoma-associated antigen E1 (MAGE-E1 antigen)| (Hepatocellular carcinoma-associated protein 1) Length = 957 Score = 28.9 bits (63), Expect = 3.1 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +1 Query: 157 PPSAIPCSSTICPQLQSRFTSRLLPSLPGIGNDASTLLPKQTLDTSGSKSTLIKRPDESQ 336 PP++ ST P S S LP PG G ST +P + G ++++ PDE Sbjct: 141 PPTSSEEPSTSVPPTASEVPSTSLPPTPGEG--TSTSVPPTAYE--GPSTSVVPTPDEGP 196 Query: 337 QIS 345 S Sbjct: 197 STS 199
>PA2I_VIPAE (P04084) Phospholipase A2 inhibitor (Vipoxin toxic component)| (Vipoxin A chain) (Inh) Length = 122 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -1 Query: 377 ACYTDSFNEAELIC*DSSGLLISVLLEPEVSSVCLGSRVD 258 A YT SF +++C D+ L +V +++CLG V+ Sbjct: 62 ATYTYSFENGDIVCGDNDLCLRAVCECDRAAAICLGENVN 101
>PA2I_VIPAP (Q8JFG1) Phospholipase A2 inhibitor precursor (Vaspin A chain)| Length = 138 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -1 Query: 377 ACYTDSFNEAELIC*DSSGLLISVLLEPEVSSVCLGSRVD 258 A YT SF +++C D+ L +V +++CLG V+ Sbjct: 78 ATYTYSFENGDIVCGDNDLCLRAVCECDRAAAICLGENVN 117
>PA21B_VIPAZ (Q10754) Phospholipase A2, A chain precursor (Phospholipase A2| inhibitor) (PLA2-I complex A chain) (Vaspin A chain) Length = 138 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -1 Query: 377 ACYTDSFNEAELIC*DSSGLLISVLLEPEVSSVCLGSRVD 258 A YT SF +++C D+ L +V +++CLG V+ Sbjct: 78 ATYTYSFENGDIVCGDNDLCLRAVCECDRAAAICLGENVN 117
>ATK4_ARATH (O81635) Kinesin-4 (Kinesin-like protein D)| Length = 987 Score = 28.1 bits (61), Expect = 5.2 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +1 Query: 160 PSAIPCSSTICPQLQSRFTSRLLPSLPGIGNDASTLLPKQTLDTSGSKS 306 P+AIP + + +S T + P LP +GN ++ P Q +D SG ++ Sbjct: 760 PTAIPINRERISRRRSLETPTIRPKLPTMGNTSNNSRP-QIMDLSGPEA 807
>LHR2A_RAT (Q75WE7) Loss of heterozygosity 11 chromosomal region 2 gene A| protein homolog (Mast cell surface antigen 1) (Masa-1) Length = 822 Score = 28.1 bits (61), Expect = 5.2 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 241 GIGNDASTLLPKQTLDTSGSKSTLIKRPDESQQISSASLKLSV 369 GIG AST L K SG + I D Q + SLKL++ Sbjct: 420 GIGQGASTSLIKNIARVSGGTAEFITGKDRMQAKALGSLKLAL 462
>PPK_STAS1 (Q4A040) Polyphosphate kinase (EC 2.7.4.1) (Polyphosphoric acid| kinase) (ATP-polyphosphate phosphotransferase) Length = 719 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 160 PSAIPCSSTICPQLQSRFTSRLLPSLPGIGNDASTLLPK 276 P +P + PQL+S F +LP+L +G DA PK Sbjct: 124 PEQLP--DDLLPQLESEFKYGILPTLTPLGIDAYHPFPK 160
>CCMF_ARATH (P93286) Putative cytochrome c biogenesis ccmF-like mitochondrial| protein Length = 442 Score = 27.3 bits (59), Expect = 8.9 Identities = 20/61 (32%), Positives = 25/61 (40%), Gaps = 9/61 (14%) Frame = +2 Query: 200 FRADLPLG---------CCLRCQG*GMMHPPCFPSKHLTLQVLKAHLSRDQTSLNKSAQL 352 F LPLG CCLR G +H P F S L + K+ L+ D+ L Sbjct: 267 FTQRLPLGYELHMGKERCCLR--GLDHLHGPTFHSICGNLMIYKSSLTNDRLMFEHDESL 324 Query: 353 H 355 H Sbjct: 325 H 325
>IAA31_ORYSA (P0C133) Auxin-responsive protein IAA31 (Indoleacetic acid-induced| protein 31) Length = 197 Score = 27.3 bits (59), Expect = 8.9 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 235 LPGIGNDASTLLPKQTLDTSGSKSTLIKRPDESQQISSASLKLSV*QAPWPP 390 LPG +A+ P + +GSK L PD+++ +A+ K V WPP Sbjct: 13 LPGTEEEAA---PPPSTPRAGSKRALAGEPDQAKIKPAAAAKAQV--VGWPP 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,622,219 Number of Sequences: 219361 Number of extensions: 907391 Number of successful extensions: 2377 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2368 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)