| Clone Name | rbastl33h07 |
|---|---|
| Clone Library Name | barley_pub |
>UPPS_STRP8 (Q8NZB2) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 249 Score = 31.2 bits (69), Expect = 1.0 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = -1 Query: 402 THMVLASGGKNI*YCSDGKGGWSQSNIQRMIFGHLRKLKLMNYVVETWAEKAATV 238 T VL S K+I DG G W++ ++ +FGH + + V T +E V Sbjct: 9 TKKVLGSIPKHIGIIMDGNGRWAKKRLKPRVFGHKAGMDALQEVTITASELGVKV 63
>UPPS_STRP6 (Q5X9U4) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 249 Score = 31.2 bits (69), Expect = 1.0 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = -1 Query: 402 THMVLASGGKNI*YCSDGKGGWSQSNIQRMIFGHLRKLKLMNYVVETWAEKAATV 238 T VL S K+I DG G W++ ++ +FGH + + V T +E V Sbjct: 9 TKKVLGSIPKHIGIIMDGNGRWAKKRLKPRVFGHKAGMDALQEVTITASELGVKV 63
>UPPS_STRP1 (Q99XY1) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 249 Score = 31.2 bits (69), Expect = 1.0 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = -1 Query: 402 THMVLASGGKNI*YCSDGKGGWSQSNIQRMIFGHLRKLKLMNYVVETWAEKAATV 238 T VL S K+I DG G W++ ++ +FGH + + V T +E V Sbjct: 9 TKKVLGSIPKHIGIIMDGNGRWAKKRLKPRVFGHKAGMDALQEVTITASELGVKV 63
>KRA55_HUMAN (Q701N2) Keratin-associated protein 5-5 (Keratin-associated protein| 5.5) (Ultrahigh sulfur keratin-associated protein 5.5) (Keratin-associated protein 5-11) (Keratin-associated protein 5.11) Length = 221 Score = 28.9 bits (63), Expect = 5.2 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -1 Query: 132 CFSGLVLSFVYEFCCFP---DGLCCFFCSSGA*IGTNCYSSLAYQP 4 C SG S CC P CC CS + G++C S Y+P Sbjct: 159 CSSGCGSSCCQSSCCKPYCCQSSCCKPCSCFSGCGSSCCQSSCYKP 204
>UPPS_FRATT (Q5NHX6) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 257 Score = 28.9 bits (63), Expect = 5.2 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 354 DGKGGWSQSNIQRMIFGHLRKLKLMNYVVETWAE 253 DG G W++S ++ IFGH + ++ +E E Sbjct: 34 DGNGRWAKSRLKPRIFGHRNSVSSVDATIEYCVE 67
>SMI2_DEBHA (Q6BJY4) KNR4/SMI1 homolog 2| Length = 590 Score = 28.9 bits (63), Expect = 5.2 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -1 Query: 330 SNIQRMIFGHLRKLKLMNYVVETWAEKAATVDGARGKHDH 211 SN+Q +FG + L+L N+ ++ + +DG+R D+ Sbjct: 311 SNLQEFMFGFVSDLELGNFQIDQNDQDGGFLDGSRNDDDY 350
>CCL28_CANFA (Q68A91) Small inducible cytokine A28 precursor (CCL28)| Length = 128 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 3 QADTQGLSNNLCQFKHPKNRKNSTSHQENNKIH 101 QA + N+C K RK+ +HQE +IH Sbjct: 90 QAAKKNTKGNICHKKQAGKRKSKGAHQEKPEIH 122
>YIP2_YEAST (P40455) Hypothetical 27.2 kDa protein in IMP2-DNA43 intergenic| region Length = 235 Score = 28.1 bits (61), Expect = 8.8 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = +2 Query: 53 EEQKKQHKPSGKQQNSYTNDKTKPLKQ-VQIVQW--KATQSTLK 175 +E KQ + ++QN + + T PL+Q VQ QW A+ S+LK Sbjct: 78 QEHHKQQQQQQQRQNIRSQNSTPPLRQLVQESQWTSSASNSSLK 121
>UPPS_STRP3 (Q8K5S5) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 249 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = -1 Query: 402 THMVLASGGKNI*YCSDGKGGWSQSNIQRMIFGHLRKLKLMNYVVETWAEKAATV 238 T V K+I DG G W++ ++ +FGH + + V T +E V Sbjct: 9 TKKVFGGIPKHIGIIMDGNGRWAKKRLKPRVFGHKAGMDALQEVTITASELGVKV 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,148,925 Number of Sequences: 219361 Number of extensions: 986737 Number of successful extensions: 2609 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2609 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)