Clone Name | rbastl33g12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TBG_SCHPO (P25295) Tubulin gamma chain (Gamma tubulin) | 31 | 0.91 | 2 | TBG_EMENI (P18695) Tubulin gamma chain (Gamma tubulin) | 30 | 1.5 | 3 | GTRA_SHIFL (P37785) Bactoprenol-linked glucose translocase | 30 | 1.5 | 4 | TBG_SCHJP (Q9Y882) Tubulin gamma chain (Gamma tubulin) | 28 | 4.5 | 5 | TBG_USTVI (P32348) Tubulin gamma chain (Gamma tubulin) | 28 | 7.7 |
---|
>TBG_SCHPO (P25295) Tubulin gamma chain (Gamma tubulin)| Length = 446 Score = 30.8 bits (68), Expect = 0.91 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +3 Query: 84 SCVFLFKNTVMQYTRPKKKNILFL*QYKKRAL 179 S LFK T+ QY R +K+N FL QYKK A+ Sbjct: 383 SIASLFKRTLDQYDRLRKRN-AFLEQYKKEAI 413
>TBG_EMENI (P18695) Tubulin gamma chain (Gamma tubulin)| Length = 454 Score = 30.0 bits (66), Expect = 1.5 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = +3 Query: 84 SCVFLFKNTVMQYTRPKKKNILFL*QYKKRA 176 S LFK V QY R +K+N FL QYKK A Sbjct: 382 SVATLFKRIVQQYDRLRKRN-AFLEQYKKEA 411
>GTRA_SHIFL (P37785) Bactoprenol-linked glucose translocase| Length = 124 Score = 30.0 bits (66), Expect = 1.5 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 16/95 (16%) Frame = +1 Query: 31 SIHRGICVLCYKNVAY-----NIPVFFYSKTLS------CSILDQKKRT----YCFFSSI 165 ++H G+ CY N+A+ NI F + T S CS + + FF Sbjct: 24 ALHWGVFYACYNNLAFGQGRSNIVGFICAATFSFFANARCSFKVSATKARYFIFIFFMGA 83 Query: 166 RSVLFTILFELNYFTNLTGKLVTSLFK-SLGWLAA 267 S LF +LF+L + + SLF LG+ A+ Sbjct: 84 MSYLFGVLFDLLALSPIFTLFTFSLFSLVLGYCAS 118
>TBG_SCHJP (Q9Y882) Tubulin gamma chain (Gamma tubulin)| Length = 446 Score = 28.5 bits (62), Expect = 4.5 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 84 SCVFLFKNTVMQYTRPKKKNILFL*QYKKRAL 179 S LFK T+ QY R +K+N FL QY+K ++ Sbjct: 383 SIASLFKRTLDQYDRLRKRN-AFLDQYRKESI 413
>TBG_USTVI (P32348) Tubulin gamma chain (Gamma tubulin)| Length = 469 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +3 Query: 96 LFKNTVMQYTRPKKKNILFL*QYKKRAL 179 +FK TV QY + +K+N F+ QY+K A+ Sbjct: 388 IFKRTVAQYDQLRKRN-AFMPQYQKEAM 414 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,299,063 Number of Sequences: 219361 Number of extensions: 728832 Number of successful extensions: 1766 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1766 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)