ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl33g06 |
|---|---|
| Clone Library Name | barley_pub |
>NBR1_PONPY (Q5RC94) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) Length = 894 Score = 34.3 bits (77), Expect = 0.12 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = -3 Query: 247 LLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 125 L+A L EMGF DR+ N +LL K+ +I + V +L+ D Sbjct: 848 LMAHLFEMGFCDRQLNLQLLKKHNYNILQVVTELLQLNNND 888 Score = 28.1 bits (61), Expect = 8.3 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -3 Query: 352 MGFKQVDLNKEILRQNKYNLEQSVDDLCGVNEWD 251 MGF LN ++L+++ YN+ Q V +L +N D Sbjct: 855 MGFCDRQLNLQLLKKHNYNILQVVTELLQLNNND 888
>DSK2_SCHPO (Q10169) Deubiquitination-protection protein dph1| Length = 354 Score = 33.9 bits (76), Expect = 0.15 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = -3 Query: 244 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIA 140 L++L+EMGF D E N + L ++GG+++ A+ L++ Sbjct: 318 LSQLNEMGFVDFERNVQALRRSGGNVQGAIESLLS 352
>NBR1_RAT (Q501R9) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) Length = 983 Score = 33.5 bits (75), Expect = 0.20 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = -3 Query: 247 LLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 125 L+A L EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 937 LMAHLFEMGFCDRQLNLRLLRKHNHNILQVVTELLQVNNND 977
>NBR1_HUMAN (Q14596) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) (Membrane component, chromosome 17, surface marker 2) (1A1-3B) Length = 966 Score = 33.5 bits (75), Expect = 0.20 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = -3 Query: 247 LLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 125 L+A L EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 920 LMARLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNND 960
>UBQL1_RAT (Q9JJP9) Ubiquilin-1 (Protein linking IAP with cytoskeleton 1)| (PLIC-1) Length = 582 Score = 33.1 bits (74), Expect = 0.26 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = -3 Query: 295 LEQSVDDLCGVN--------EWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIA 140 ++Q + L GVN + L +LS MGF +RE N + L GG I A+ L+ Sbjct: 519 IQQMLQALAGVNPQLQSPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLG 578 Query: 139 RE 134 + Sbjct: 579 SQ 580
>UBQL1_MOUSE (Q8R317) Ubiquilin-1 (Protein linking IAP with cytoskeleton 1)| (PLIC-1) Length = 582 Score = 33.1 bits (74), Expect = 0.26 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = -3 Query: 295 LEQSVDDLCGVN--------EWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIA 140 ++Q + L GVN + L +LS MGF +RE N + L GG I A+ L+ Sbjct: 519 IQQMLQALAGVNPQLQSPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLG 578 Query: 139 RE 134 + Sbjct: 579 SQ 580
>UBQL1_HUMAN (Q9UMX0) Ubiquilin-1 (Protein linking IAP with cytoskeleton 1)| (PLIC-1) (hPLIC-1) Length = 589 Score = 33.1 bits (74), Expect = 0.26 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = -3 Query: 295 LEQSVDDLCGVN--------EWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIA 140 ++Q + L GVN + L +LS MGF +RE N + L GG I A+ L+ Sbjct: 526 IQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLG 585 Query: 139 RE 134 + Sbjct: 586 SQ 587
>NBR1_MOUSE (P97432) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) (Membrane component, chromosome 17, surface marker 2) Length = 988 Score = 33.1 bits (74), Expect = 0.26 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = -3 Query: 247 LLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 125 L+A L EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 942 LMAHLFEMGFCDRQLNLRLLRKHNYNILQVVTELLQVNNND 982 Score = 29.6 bits (65), Expect = 2.9 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -3 Query: 352 MGFKQVDLNKEILRQNKYNLEQSVDDLCGVNEWD 251 MGF LN +LR++ YN+ Q V +L VN D Sbjct: 949 MGFCDRQLNLRLLRKHNYNILQVVTELLQVNNND 982
>UBQL2_HUMAN (Q9UHD9) Ubiquilin-2 (Protein linking IAP with cytoskeleton 2)| (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2) (DSK2 homolog) (Chap1) Length = 624 Score = 32.3 bits (72), Expect = 0.44 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 9/67 (13%) Frame = -3 Query: 307 NKYNLEQSVDDLCGVN---------EWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAV 155 N+ ++Q V L G N + L +L+ MGF +RE N + L GG I A+ Sbjct: 556 NQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAI 615 Query: 154 MDLIARE 134 L+ + Sbjct: 616 ERLLGSQ 622
>UBL7_MOUSE (Q91W67) Ubiquitin-like protein 7 (Ubiquitin-like protein SB132)| Length = 380 Score = 31.2 bits (69), Expect = 0.99 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 262 NEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAV 155 ++W P L +L +MG D E + L GG I+ A+ Sbjct: 336 SQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAAL 371
>UBL7_HUMAN (Q96S82) Ubiquitin-like protein 7 (Ubiquitin-like protein SB132)| (Bone marrow stromal cell ubiquitin-like protein) (BMSC-UbP) Length = 380 Score = 31.2 bits (69), Expect = 0.99 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 262 NEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAV 155 ++W P L +L +MG D E + L GG I+ A+ Sbjct: 336 SQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAAL 371
>GTS1_YEAST (P40956) Protein GTS1 (Protein LSR1)| Length = 396 Score = 30.8 bits (68), Expect = 1.3 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 244 LAELSEMGFDDRETNKELLAKNGGSIKRAV 155 LAEL +MGF D N + L+ G+I RA+ Sbjct: 199 LAELKDMGFGDTNKNLDALSSAHGNINRAI 228
>UBQL4_HUMAN (Q9NRR5) Ubiquilin-4 (Ataxin-1 ubiquitin-like-interacting protein| A1U) Length = 601 Score = 30.4 bits (67), Expect = 1.7 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 244 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 134 L +L+ MGF +RE N + L GG I A+ L+ + Sbjct: 563 LEQLNSMGFINREANLQALIATGGDINAAIERLLGSQ 599
>UBQL4_MOUSE (Q99NB8) Ubiquilin-4 (Ataxin-1 ubiquitin-like-interacting protein| A1U) Length = 596 Score = 30.4 bits (67), Expect = 1.7 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 244 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 134 L +L+ MGF +RE N + L GG I A+ L+ + Sbjct: 558 LEQLNSMGFINREANLQALIATGGDINAAIERLLGSQ 594
>SYM_STRR6 (P67581) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 665 Score = 30.4 bits (67), Expect = 1.7 Identities = 24/68 (35%), Positives = 34/68 (50%) Frame = -3 Query: 331 LNKEILRQNKYNLEQSVDDLCGVNEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAVM 152 LN+ + NKY Q + GV E+D +LAE++E D T+ E A + AV Sbjct: 369 LNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHME--AVDYPRALEAVW 426 Query: 151 DLIAREKK 128 LI+R K Sbjct: 427 TLISRTNK 434
>SYM_STRPN (P67580) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 665 Score = 30.4 bits (67), Expect = 1.7 Identities = 24/68 (35%), Positives = 34/68 (50%) Frame = -3 Query: 331 LNKEILRQNKYNLEQSVDDLCGVNEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAVM 152 LN+ + NKY Q + GV E+D +LAE++E D T+ E A + AV Sbjct: 369 LNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHME--AVDYPRALEAVW 426 Query: 151 DLIAREKK 128 LI+R K Sbjct: 427 TLISRTNK 434
>UBQL2_MOUSE (Q9QZM0) Ubiquilin-2 (Protein linking IAP with cytoskeleton 2)| (PLIC-2) (Ubiquitin-like product Chap1/Dsk2) (DSK2 homolog) (Chap1) Length = 638 Score = 29.6 bits (65), Expect = 2.9 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 244 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 134 L +L+ MGF +RE N + L GG I A+ L+ + Sbjct: 600 LEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQ 636
>DSK2_YEAST (P48510) Ubiquitin domain-containing protein DSK2| Length = 373 Score = 29.3 bits (64), Expect = 3.7 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -3 Query: 244 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLI 143 L +L++MGF D + N L ++GGS++ A+ L+ Sbjct: 336 LRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLL 369
>SAHH_YEAST (P39954) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 449 Score = 28.9 bits (63), Expect = 4.9 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 6/60 (10%) Frame = +2 Query: 107 SSRSSLVLLLPGDEVH------HSSFDASSILGKQLLVRLPVIKSHFAQFRQQRVPFIDT 268 SS ++LL G V+ HSSF S Q+L ++ + KS+ FR++ + F T Sbjct: 334 SSGRHVILLANGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKSNDKSFREKHIEFQKT 393
>MURD_CHRVO (Q7NPZ7) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 453 Score = 28.5 bits (62), Expect = 6.4 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +2 Query: 134 LPGDEVHHSSFDASSILGKQLLV---RLPVIKSHFAQFRQQRVPFIDTTQIIHRLLQ 295 LPG EV +FD ++ G +LLV +P+ A FR+ + +I+ R +Q Sbjct: 50 LPGVEVMVGAFDDATFAGAELLVVSPGVPLANPAIAAFRRAGGEVVGDIEILARAIQ 106
>PDE3B_HUMAN (Q13370) cGMP-inhibited 3',5'-cyclic phosphodiesterase B (EC| 3.1.4.17) (Cyclic GMP-inhibited phosphodiesterase B) (CGI-PDE B) (CGIPDE1) (CGIP1) Length = 1112 Score = 28.5 bits (62), Expect = 6.4 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = -3 Query: 331 LNKEILRQNKYNLEQSVD-DLCGVNEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAV 155 L +E + + N+EQ V DL V E+D L+ ++S F E +++ K+G + + + Sbjct: 641 LTEEAQSEQQTNIEQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVM 700 Query: 154 MDL 146 L Sbjct: 701 YTL 703
>KNOX3_MAIZE (P56661) Homeobox protein knotted-1-like 3 (Fragment)| Length = 88 Score = 28.5 bits (62), Expect = 6.4 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 217 DDRETNKELLAKNGGSIKRAVMDLIAREKKDK 122 DD+E K+LL K G + +L + KKDK Sbjct: 1 DDKELKKQLLRKYSGCLGNLRKELCKKRKKDK 32
>UBQL3_HUMAN (Q9H347) Ubiquilin-3| Length = 655 Score = 28.1 bits (61), Expect = 8.3 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -3 Query: 244 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDL 146 L +L MGF +RE N + L GG + AV L Sbjct: 620 LEQLRSMGFLNREANLQALIATGGDVDAAVEKL 652
>PRIM_MYCPU (Q98QB3) DNA primase (EC 2.7.7.-)| Length = 602 Score = 28.1 bits (61), Expect = 8.3 Identities = 18/59 (30%), Positives = 31/59 (52%) Frame = -3 Query: 337 VDLNKEILRQNKYNLEQSVDDLCGVNEWDPLLAELSEMGFDDRETNKELLAKNGGSIKR 161 +D E L +KYN+ S + VN++ PLL+ + + D E LL K+ +I++ Sbjct: 361 IDYLYEFLLTSKYNINNSEHLISFVNDFAPLLSSQNNIVIDKYE---NLLMKHSINIRK 416
>OS9_KLULA (Q6CNH1) Protein OS-9 homolog precursor| Length = 457 Score = 28.1 bits (61), Expect = 8.3 Identities = 26/97 (26%), Positives = 38/97 (39%) Frame = -3 Query: 304 KYNLEQSVDDLCGVNEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 125 KY L + LC ++ ++PLL +LSE ++ GS +D+ R Sbjct: 209 KYQLRLFLPQLCELSSFNPLLGQLSE---------HNIICHRSGSKLSPALDIFNRYSAT 259 Query: 124 K*RS*ALEHLFIYIYLYMPK*RDSVSRSLPMNCCEDL 14 L+H IYL PK R L + E L Sbjct: 260 -----VLDH---GIYLLKPKNSAKDRRQLMYHAAEPL 288
>RNF31_HUMAN (Q96EP0) RING finger protein 31 (Zinc in-between-RING-finger| ubiquitin-associated domain protein) Length = 1072 Score = 28.1 bits (61), Expect = 8.3 Identities = 15/51 (29%), Positives = 29/51 (56%) Frame = -3 Query: 298 NLEQSVDDLCGVNEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAVMDL 146 NL+++V++ V + EL +GF E + + L ++GG + RA+ +L Sbjct: 564 NLDEAVEEC--VRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTEL 612
>DT3E_PSECI (O50580) D-tagatose 3-epimerase (EC 5.3.1.-)| Length = 290 Score = 28.1 bits (61), Expect = 8.3 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 256 WDPLLAELSEMGFDDRETNKELLAKNGGSIKRAV 155 WD + L E+G+D + + K GGS+ RAV Sbjct: 227 WDEIFGALKEIGYDGTIVMEPFMRK-GGSVSRAV 259
>RNF31_MOUSE (Q924T7) RING finger protein 31| Length = 1066 Score = 28.1 bits (61), Expect = 8.3 Identities = 15/51 (29%), Positives = 30/51 (58%) Frame = -3 Query: 298 NLEQSVDDLCGVNEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAVMDL 146 NL+++V++ V + EL +GF +E + + L ++GG + RA+ +L Sbjct: 558 NLDEAVEEC--VRARRRKVHELQSLGFGPKEGSLQALFQHGGDVARALTEL 606 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,237,377 Number of Sequences: 219361 Number of extensions: 986692 Number of successful extensions: 2632 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 2591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2632 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
