Clone Name | rbastl33e06 |
---|---|
Clone Library Name | barley_pub |
>IPP1_RAT (P19103) Protein phosphatase inhibitor 1 (IPP-1) (I-1)| Length = 171 Score = 31.2 bits (69), Expect = 1.2 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +3 Query: 132 DNSNYSTPVLKKTRNCCPRKKKKGTGVYGWSSAPVLKNLRMTRNHSLVQIKNG 290 D P+LK T + PR++KK T + P +K L+ H L Q K G Sbjct: 51 DEDRIPNPLLKSTLSMSPRQRKKMT-----RTTPTMKELQTMVEHHLGQQKQG 98
>SGP1_SCHGR (O46162) Serine protease inhibitor I/II precursor [Contains:| Protease inhibitor SGPI-1 (Schistocerca gregaria trypsin inhibitor) (SGTI); Protease inhibitor SGPI-2 (Schistocerca gregaria chymotrypsin inhibitor) (SGCI)] Length = 92 Score = 30.4 bits (67), Expect = 2.0 Identities = 19/51 (37%), Positives = 29/51 (56%) Frame = +3 Query: 54 VLLLLVQLKRNCCPRKTKTRNCE*FTDNSNYSTPVLKKTRNCCPRKKKKGT 206 +L++LVQ ++ C P +TK ++C T N T V TR CP K++ T Sbjct: 12 LLVVLVQAEQECTPGQTKKQDCN--TCNCT-PTGVWACTRKGCPPHKREVT 59
>IPP1_HUMAN (Q13522) Protein phosphatase inhibitor 1 (IPP-1) (I-1)| Length = 171 Score = 29.6 bits (65), Expect = 3.5 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +3 Query: 132 DNSNYSTPVLKKTRNCCPRKKKKGTGVYGWSSAPVLKNLRMTRNHSLVQIKNG 290 D P LK T PR++KK T + P +K L+M H L Q + G Sbjct: 51 DEDRIPNPHLKSTLAMSPRQRKKMTRI-----TPTMKELQMMVEHHLGQQQQG 98
>IPP1_CANFA (Q8WMS3) Protein phosphatase inhibitor 1 (IPP-1) (I-1)| Length = 171 Score = 29.6 bits (65), Expect = 3.5 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +3 Query: 132 DNSNYSTPVLKKTRNCCPRKKKKGTGVYGWSSAPVLKNLRMTRNHSLVQIKNG 290 D P LK T PR++KK T + P +K L+M H L Q + G Sbjct: 51 DEDRIPNPHLKSTLAMSPRQRKKMTRI-----TPTMKELQMMVEHHLGQQQQG 98
>LAMA4_HUMAN (Q16363) Laminin alpha-4 chain precursor| Length = 1823 Score = 29.6 bits (65), Expect = 3.5 Identities = 14/58 (24%), Positives = 25/58 (43%) Frame = +3 Query: 189 KKKKGTGVYGWSSAPVLKNLRMTRNHSLVQIKNGVQIVRAMIIT*VSFMPGGWHSVII 362 + GT V+G S N+ M +V++ NG++ + S G WH + + Sbjct: 1679 RSSSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITV 1736
>HRF1_NPVLD (Q90165) Host range factor 1| Length = 218 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +2 Query: 158 PEKNKELLSSQKKKRNWSIWLEFCTCPEKPAHDAKSFPGSNKKWCSDSPSN 310 PE+ E + ++R + + C + AHD F KWCS P + Sbjct: 79 PEEWLEYIDDDDEERERQVEVFVCMKGDCYAHDGPLFVSEASKWCSREPEH 129
>CDKL2_RAT (Q5XIT0) Cyclin-dependent kinase-like 2 (EC 2.7.11.22)| Length = 507 Score = 29.3 bits (64), Expect = 4.5 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = +2 Query: 44 CKHGPSATRAAEKELLSSQNKNKEL*IVYRQFKLLYTCPEKN-KELLSSQKKKRNWSIWL 220 C++ S A K+ L S + I R+ KLL +N LL KKK+ W + Sbjct: 21 CRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNLLEVCKKKKRWYLVF 80 Query: 221 EF 226 EF Sbjct: 81 EF 82
>CDKL2_MOUSE (Q9QUK0) Cyclin-dependent kinase-like 2 (EC 2.7.11.22)| (Serine/threonine-protein kinase KKIAMRE) Length = 568 Score = 29.3 bits (64), Expect = 4.5 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = +2 Query: 44 CKHGPSATRAAEKELLSSQNKNKEL*IVYRQFKLLYTCPEKN-KELLSSQKKKRNWSIWL 220 C++ S A K+ L S + I R+ KLL +N LL KKK+ W + Sbjct: 21 CRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNLLEVCKKKKRWYLVF 80 Query: 221 EF 226 EF Sbjct: 81 EF 82
>CDKL2_RABIT (Q9TTK0) Cyclin-dependent kinase-like 2 (EC 2.7.11.22)| (Serine/threonine-protein kinase KKIAMRE) Length = 566 Score = 29.3 bits (64), Expect = 4.5 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = +2 Query: 44 CKHGPSATRAAEKELLSSQNKNKEL*IVYRQFKLLYTCPEKN-KELLSSQKKKRNWSIWL 220 C++ S A K+ L S + I R+ KLL +N LL KKK+ W + Sbjct: 21 CRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNLLEVCKKKKRWYLVF 80 Query: 221 EF 226 EF Sbjct: 81 EF 82
>LAMA4_MOUSE (P97927) Laminin alpha-4 chain precursor| Length = 1816 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/58 (24%), Positives = 25/58 (43%) Frame = +3 Query: 189 KKKKGTGVYGWSSAPVLKNLRMTRNHSLVQIKNGVQIVRAMIIT*VSFMPGGWHSVII 362 + GT V+G S N+ M +V++ NGV+ + + G WH + + Sbjct: 1672 RSSSGTLVHGHSVNGEYLNVHMRNGQVIVKVNNGVRDFSTSVTPKQNLCDGRWHRITV 1729
>IPP1_RABIT (P01099) Protein phosphatase inhibitor 1 (IPP-1) (I-1)| Length = 166 Score = 28.9 bits (63), Expect = 5.9 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +3 Query: 132 DNSNYSTPVLKKTRNCCPRKKKKGTGVYGWSSAPVLKNLRMTRNHSLVQIKNG 290 D P+LK + PR++KK T + P +K L+M H L Q + G Sbjct: 51 DEDRIPNPLLKPSLAMSPRQRKKMT-----RTTPTMKELQMMVEHHLGQQEQG 98
>WHITE_CERCA (Q17320) Protein white| Length = 679 Score = 28.5 bits (62), Expect = 7.7 Identities = 21/73 (28%), Positives = 31/73 (42%) Frame = -1 Query: 235 TGAELQPYTPVPFFFLRGQQFLVFFRTGVE*FELSVNYSQFLVFVLRGQQFLFSCTSSRR 56 T AEL + VPF F L+ R GV+ F ++ + V +L SC S Sbjct: 503 TIAELPLFLVVPFLFTAIAYPLIGLRPGVDHFFTALALVTLVANVSTSFGYLISCACSST 562 Query: 55 TVFAACNPHHFIP 17 ++ + P IP Sbjct: 563 SMALSVGPPVIIP 575 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,784,041 Number of Sequences: 219361 Number of extensions: 1288369 Number of successful extensions: 3040 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3040 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)