Clone Name | rbastl33d06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RDRP_PVXHB (Q07630) RNA replication protein (165 kDa protein) (O... | 28 | 4.1 | 2 | APU_THETY (P16950) Amylopullulanase precursor (Alpha-amylase/pul... | 28 | 6.9 |
---|
>RDRP_PVXHB (Q07630) RNA replication protein (165 kDa protein) (ORF 1 protein)| [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); Helicase (EC 3.6.1.-)] Length = 1456 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/66 (25%), Positives = 27/66 (40%) Frame = +3 Query: 3 GAYNTEL*HQEGTNIFKCHWRHKGFK*QTVHQHQNSRKTDTSSHFANLHYKGTFLAGHLA 182 GAY+ E H + + K WR + H N +H + + +F A HL Sbjct: 212 GAYHHEFSHLQSVKVGKIKWRDPK---DGLLGHLNYTHEQVDTHTVTVQLQESFAANHLY 268 Query: 183 LEQRGS 200 +RG+ Sbjct: 269 CIRRGN 274
>APU_THETY (P16950) Amylopullulanase precursor (Alpha-amylase/pullulanase)| [Includes: Alpha-amylase (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase); Pullulanase (EC 3.2.1.41) (1,4-alpha-D-glucan glucanohydrolase) (Alpha-dextrin endo-1,6-alpha-glucosida Length = 1475 Score = 27.7 bits (60), Expect = 6.9 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +1 Query: 22 YDIKKVQTSLNATGGTRVSNSKQYTNTKIPVKQTRAVILPTYT 150 Y + V TS N T SN+ + T IP+K T V +P YT Sbjct: 1234 YKVVAVDTSYNRTA----SNTVKATPDIIPIKVTFNVTIPDYT 1272 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,921,480 Number of Sequences: 219361 Number of extensions: 875128 Number of successful extensions: 1890 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1889 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)