Clone Name | rbastl33d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | OMPB3_NEIMB (P30688) Major outer membrane protein P.IB precursor... | 29 | 4.4 |
---|
>OMPB3_NEIMB (P30688) Major outer membrane protein P.IB precursor (Protein IB)| (PIB) (Porin) (Class 3 protein) Length = 331 Score = 29.3 bits (64), Expect = 4.4 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 4/83 (4%) Frame = -2 Query: 428 DVLQILLRCEQAHRKTIDEKTTASEYDAAPLLPAVRGGSRRKRLSDAADGKGSFDDVVLR 249 D L + +Q K +++ + + A R G+ R+S A KGSFDD L Sbjct: 223 DALHASVAVQQQDAKLVEDNYSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGSFDDADLS 282 Query: 248 N----A*VTSEYSCTRYISSIPS 192 N V +EY ++ S++ S Sbjct: 283 NDYDQVVVGAEYDFSKRTSALVS 305 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,976,812 Number of Sequences: 219361 Number of extensions: 785825 Number of successful extensions: 1723 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1723 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)